SecReT6
Protein ID: 157156295
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0240
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]261035..261259 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7ZHX0
KEGG IDecw:EcE24377A_0240
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|157156295|ref|YP_001461399.1| hypothetical protein EcE24377A_0240 [Escherichia coli E24377A]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c261259-261035 Escherichia coli E24377A chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA