SecReT6
Protein ID: 157156380
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3126
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3131679..3132344 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDA7ZQR2
KEGG IDecw:EcE24377A_3126
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-48, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|157156380|ref|YP_001464141.1| DotU family type IV/VI secretion system protein [Escherichia coli E24377A]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3131679-3132344 Escherichia coli E24377A chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGCCACTGCCAGCGGCAGGTCGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTCAGCCGTGAGAGCGTGGAGCACATTACCTACGCGCAGTGCGCCCTG
CTGGACGAAACAGTCCTGAGTCGCAGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCAGGCGAGCTGCTGTACGAGCGGATGAAGCAGGTGTTGCAGGA
GCCCGCGCCTGCACAGGCGGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGTGGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCTGGTCGCGCCATTTGGCG
TACTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTAACGCTGACGCTGCTACTGGCCGGTGTCTGGTGGGGGCTGCACCACTGGCTGAACGTG
CTGGTGGATGAATTGCTGCCGCAAAGCCTGCGGTAA