SecReT6
Protein ID: 157156439
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0229
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]247338..248750 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA7ZHV9
KEGG IDecw:EcE24377A_0229
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 152..184
Protein Sequence: 470 a.a.     [Download]
>gi|157156439|ref|YP_001461388.1| ImpA domain-containing protein [Escherichia coli E24377A]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQRRGLVILASES
KDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATA
QRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQP
SAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSAD
MVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGL
LFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c248750-247338 Escherichia coli E24377A chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATC
GCTGGCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGTGGGCTGGTCATTCTGGCTTCGGAGAGT
AAGGATTTTCGTCTGCTGGCGCATCTGCTGAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGTCAGGGGAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAAC
TGGCACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTG
GCAGAACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGAT
ATGGTGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCG
TACTGCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAA
ACAGGTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCA
GGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCAC
GGCAGAACAATAA