SecReT6
Protein ID: 157156697
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3135
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3142113..3143489 [+]
ProductImpA-related N-terminal domain-containing protein
NoteTssA
UniProt IDA7ZQS1
KEGG IDecw:EcE24377A_3135
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 42..100
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 358..376
Protein Sequence: 458 a.a.     [Download]
>gi|157156697|ref|YP_001464150.1| ImpA-related N-terminal domain-containing protein [Escherichia coli E24377A]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRRVEKLSLALFRQNGVELQTQVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMKQPEKSEESPQPVFAT
RPAQQNDKDASPSAPSPEISRQRTWPIFMAGMVVMACLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSTEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3142113-3143489 Escherichia coli E24377A chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTACAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCTGATGTGGACTGGCGTCGGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAATTACAGACGCAGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGACATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGTTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATTTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGTAATACGGCGCTACGTCTGGAGCGGCTGGCACCACAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAAGCAACCAGAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACC
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCATCCGCGCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCTGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCACTAATCCAGCGAATACAACTGTCTGTCATGCCATTACCGCAGTCGCTG
GAGAGCGGCGAGCTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGAGCGCTGAACGCGCAGTGGCGTAAA
CAGCGGGAGCTGAGCGCCCTGTCCACAGAGGCATTGAATGGCTACGCACAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCGACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTAATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA