SecReT6
Protein ID: 157157099
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0239
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]259509..260984 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7ZHW9
KEGG IDecw:EcE24377A_0239
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-188, Aligned region: 68..489
Protein Sequence: 491 a.a.     [Download]
>gi|157157099|ref|YP_001461398.1| hypothetical protein EcE24377A_0239 [Escherichia coli E24377A]
MSLQEEELVSSHAGQPEQASSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDR
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c260984-259509 Escherichia coli E24377A chromosome, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTATCCAGTCATGCCGGGCAGCCTGAGCAGGCATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGTTTCGGACAGTTTGGCGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCGCCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCCTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATTACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGTC
CGCAAAGCGGCGGCGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGA
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCA
AACCTCTGCGCGCTGCCAAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCT
AAGCGTGAGGCCTCATTTTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGG
GAGTAA