SecReT6
Protein ID: 157157465
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3128
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3134067..3134558 [+]
Producthypothetical protein
NoteTssD
UniProt IDA7ZQR4
KEGG IDecw:EcE24377A_3128
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|157157465|ref|YP_001464143.1| hypothetical protein EcE24377A_3128 [Escherichia coli E24377A]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFIFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3134067-3134558 Escherichia coli E24377A chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACTCGCACCCATAAACCGTTCATTTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGTCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ACGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAA
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA