SecReT6
Protein ID: 157157697
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0231
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]249495..252254 [-]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDA7ZHW1
KEGG IDecw:EcE24377A_0231
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 261..261
AAA_2 [PF07724], Evalue: 1.50E-38, Aligned region: 642..803
AAA [PF00004], Evalue: 7.00E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 7.00E-17, Aligned region: 648..765
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.90E-14, Aligned region: 647..767
ClpB_D2-small [PF10431], Evalue: 3.60E-12, Aligned region: 809..886
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 618..688
AAA_16 [PF13191], Evalue: 4.40E-11, Aligned region: 713..741
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 446..483
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 646..681
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 642..676
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 8.20E-05, Aligned region: 645..672
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 647..737
NACHT [PF05729], Evalue: 0.0001, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.0001, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.0001, Aligned region: 453..453
NACHT [PF05729], Evalue: 0.0001, Aligned region: 648..676
NACHT [PF05729], Evalue: 0.0001, Aligned region: 854..877
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0002, Aligned region: 641..669
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 648..666
AAA_18 [PF13238], Evalue: 0.0056, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0056, Aligned region: 648..683
IstB_IS21 [PF01695], Evalue: 0.0092, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0092, Aligned region: 647..658
AAA_17 [PF13207], Evalue: 0.0095, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0095, Aligned region: 648..682
Protein Sequence: 919 a.a.     [Download]
>gi|157157697|ref|YP_001461390.1| ATP-dependent chaperone protein ClpB [Escherichia coli E24377A]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESEQDNTGAVPADEADREQPEETAETVSPVQRLAHLT
AELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHL
LTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYV
GYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQV
IVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLASLDNVLRSRFGAEVIIE
PEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGAFTADVEDAQNDE
SVTKDETVL
 
Nucleotide Sequence: 2760 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c252254-249495 Escherichia coli E24377A chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGTCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCAC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAACAGGATAATACCGGTGCCGTACCGGCTGATGA
GGCCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGTCTGGCACATCTCACT
GCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTTTCCCCGCACGTCGATAAAAAACAGATTGCGG
CGGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGA
CCTGCCAAAATGGCTCGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCACAAACACCTG
CTGACCGCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTGGGCGCGTTCCTGCTGGCTGGCCCCAGCG
GCGTGGGTAAAACTGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCAC
CATCAATATGTCCGAGTTCCAGGAGAAACATACCGTCTCGCGACTGATTGGTTCGCCTCCGGGCTACGTT
GGCTACGGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAGTACTGCTCGATG
AAGTGGAAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAATGGCAGA
CGGTGAAGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTACCAGGTA
ATAGTCGAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGGCCGACTTCTTCA
AACCTGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCGCTGTCGAAAGAGACGCTCGCCACCAT
CATTGCCGGGAAACTGGCCAGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGAGGTGATTATAGAA
CCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGG
TCATCGACGGCAATATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGCGAATACGGCGGT
TGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCTCAGAACGACGAG
TCCGTCACAAAGGATGAAACGGTTTTATGA