SecReT6
Protein ID: 157158477
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3130
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3137406..3139913 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDA7ZQR6
KEGG IDecw:EcE24377A_3130
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.60E-63, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 1.50E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 7.20E-35, Aligned region: 480..584
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 835 a.a.     [Download]
>gi|157158477|ref|YP_001464145.1| ImpA family type VI secretion-associated protein [Escherichia coli E24377A]
MGIQNFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQTALRTLHGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPSREQVMQYGEDDLTFISRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTLPL
RHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIALLQQSVKDLTQAVILLSAPKGVAIASGEHL
QLAASKNVIANAGNNADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQ
SFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3137406-3139913 Escherichia coli E24377A chromosome, complete genome
ATGGGTATTCAGAATTTCGATCATTCACACCACAAGCTCAAAATTCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGTCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGGATGCCGGTACAGACTGCCCTGCGCACCCTGCACGGCGTCATCACCGGCTTTAAACACCTGTCATCGT
CACAGGATGAAGCCCGTTACGAAGTGCGCCTTGAACCCCGAATGGCGCTGCTGGCCCGCAGCCGCCAGAA
CGCCATTTACCAGAACCAGACGGTGCCGCAAATAGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGTCCCGTGAACAGGTGATGCAGTACGGTGAGG
ACGACCTGACGTTTATTTCACGCCTGCTGTCGGAAGTGGGTATCTGGTTCCGCTTTGCCACCGACGCCCG
GCTGAAAATTGAGGTTGTCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGCTGTTTGATGGTGAAACGGAAGCCGTATGGGGGCTGAACACCGCATACAGCGTGG
TGGAAAAAAGCGTCACCACGCGGGACTACAACTACCGCACCGCCACAGCAGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTATGGCGAAGCCTACCACTACGCTGACAACTTCCTGCAAAAA
GGCGACAAGGAGGCAGCGGAAAGCGGCGCGTTTTATGCCCGTATCCGTCACGAACGCTACCTGAATGAAC
AGGCCATTCTGCAGGGCCAGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCCCGTGACCGC
AGCTATGAACTGACGTTCACGGCGATACCCTACTCAGAACGCTACGGCTATCGCCCGGCGCTTATCCCCC
GCCCCGTAATGGCCGGAACACTCCCGGCGCGGGTCACCAGCACGGTGAAAAACGATATTTATGCCCATAT
AGACAAAGACGGGCGCTACCGGGTCAACCTCGATTTTGACCGCGATACGTGGAAACCGGGTTATGAGAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCGAACAACAAA
ATCCGCCTCGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGT
TGAATCTGGGTCATCTGGTGGATGCCGGAAAACAACAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGGCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGCAGTCGCTGTCCACTG
ATGCGCAGACGACGAATGCCGATCCGGCAGATCTGTCATCGCAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACGCAGGCCGTGATCCTGCTAAGTGCACCCAAGGGCGTGGCGATCGCCAGCGGCGAGCACCTG
CAACTGGCGGCGTCGAAGAATGTGATAGCGAACGCAGGCAACAACGCAGATATCGGCGTAGTAAAAAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGTAAAGCGGGCATCAAGCTGTTTGCCAATAA
AGGGGCGGTCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGAGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATATTACGGGCG
TAAACCAAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTTAATCAG
AGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAACTGGAAA
GTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAAGGAGGA
GGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGACATTAATTAA