SecReT6
Protein ID: 157158534
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0246
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]265437..269684 [+]
ProductRhs protein
NotePAAR
UniProt IDA7ZHX6
KEGG IDecw:EcE24377A_0246
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 232..246
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 328..364
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 371..387
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 437..475
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 461..495
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 501..524
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 545..580
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 587..623
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 629..664
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 670..700
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 702..721
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 732..765
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 826..838
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 855..863
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 878..909
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 958..995
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 1010..1020
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 1043..1060
RHS_repeat [PF05593], Evalue: 2.60E-59, Aligned region: 1168..1194
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 372..385
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 958..966
RHS [PF03527], Evalue: 1.90E-20, Aligned region: 1162..1202
Protein Sequence: 1415 a.a.     [Download]
>gi|157158534|ref|YP_001461405.1| Rhs protein [Escherichia coli E24377A]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPNSPIEEQKGNPVNPLLGAKVLPGETDLALP
CPLPFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQVHERELILNDSGGRSIHFEPLFPGEISYSRSE
SLWLARGGVAAQHSSQPLSALWQVLPEDVRLSPHVYLATNSLQGPWWILSWPERVPGADEVLPPEPPAYR
VLTGVVDGFGRTLAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSAS
SSLVFPDTLPAGTGYGTDNGIRLEAVWLTHDPAYPDEQPTAPLARYTYTAGGELRAVYDRSGTQVRGFTY
DAEHAGRMVAHHYAGRPESCYRYDDTGRVTEQVNPEGLDYRFEYGESRVIITDSLNRREVLYTEGEGGLK
RVVKKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVT
YPDGLRSSREYDEKGRLTAETSRSGETTRYSYDDPASELPTGIQDAMGSTKQMAWSRYGQLLAFTDCSGY
TTRYEYDRYGQQIAVHREEGISTYSSYNPRGQMVSQKDAQGRETPYEYSAAGDLTATVSPDGKRSTIAYD
KRGRPVSVTEGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTRKLTQS
EDEGLITLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVE
NPETGELLWQHETKHAYNEQGLANRVTPDSLPPVEWLTYGSGYLAGMKLGGTPLVEYTRDRLHRETVRSF
GSRAGSNAAYELTSTYTPAGQLQSQHLNSLVYDRDYGWNDNGDLVRISGPRQTREYGYSATGRLESVRTL
APDLDIRIPYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYVYHYDEYGRLTEKTDRIPTGVIRTDD
ERTHHYHYDSQHRLVFHTRIQHGEPLVESRYLYDPLGRRMAKRVWRRERDLTGWMSLSRKPEETWYGWDG
DRLTTVQTDTTRIQTVYQPGSFAPLIRIETDNGEREKAQCRSLAEKIQQEGSEDGHGVVFPAELVGLLDR
LEGEIRANCVSSESRQWLAQCGLTVERLAAQIEPVYLPERKIHLYHCDHRGLPLALISEDGNTAWSAEYD
EWGNQLNEENPHHLHQPYRMPGQQYDKESGLYYNRHRYYDPLQGRYITPDPIGLRGGWNMYQYPLNPIQV
IDPMGLDAIENMTSGGLIYAVSGVPGLIAANSITNSAYQFGYDMDAIVGGAHNGAADAMRHCYLMCRMTK
TFGSTIADVIGKNHEAAGDRQGQPAKERIMDLKNNTVGIACGDFSAKCSDACIEKYNTGQLFGLDGIKAD
NPIKAKQGSSDASNY
 
Nucleotide Sequence: 4248 bp     [Download]
>gi|157154711|ref|NC_009801.1|:265437-269684 Escherichia coli E24377A chromosome, complete genome
ATGGGCGGAAAACCGGCAGCGCGGCAGGGTGATATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CAGGGGTGCTGATAGGCGCGCCGACGGGAGTGGCCTGTTCGGTATGTCCCAACAGCCCGATAGAGGAGCA
GAAGGGTAACCCGGTGAACCCGCTGCTGGGAGCAAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCC
TGCCCGTTGCCGTTTATTCTTTCCCGCGCCTACAGCAGTTACCGGACCAGGACGCCCGCGCCGGTGGGGG
TGTTCGGTCCCGGCTGGAAAGCACCCTTCGATATCCGCTTACAGGTTCATGAGCGGGAACTGATACTCAA
CGACAGCGGCGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAG
TCACTCTGGCTGGCGCGGGGCGGGGTGGCGGCGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGG
TGCTGCCGGAAGATGTTCGCCTGAGTCCGCATGTGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTG
GATACTCAGCTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGG
GTGCTGACGGGCGTGGTGGACGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCGGCGGAGGGTGATGTGG
CGGGCGCGGTGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGTGCTGACCACACAGGCACA
GCGGGCGGAAGTATTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCC
TCTTCTCTGGTTTTCCCCGACACGCTGCCCGCCGGTACAGGATACGGCACGGATAACGGTATCCGGCTGG
AGGCGGTATGGCTGACACACGACCCGGCATACCCGGATGAACAGCCGACTGCGCCGCTGGCGCGCTACAC
GTACACGGCCGGTGGTGAACTGCGGGCGGTGTATGACCGCAGCGGAACGCAGGTGCGCGGGTTTACTTAT
GATGCGGAGCACGCCGGGCGGATGGTGGCGCACCATTATGCGGGGAGGCCGGAGAGCTGCTACCGGTATG
ATGATACCGGTCGGGTGACGGAGCAGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGAGAGAG
CCGGGTAATCATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTGAAG
CGGGTGGTGAAGAAGGAACATGCGGACGGGAGCATTACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGA
AGGCACAGACGGATGCGGCGGGGCGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACGGC
GGTGACGGGGCCGGACGGCAGGACGGTACGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCGGTGACG
TACCCGGACGGGCTTCGCAGCAGCCGGGAGTATGATGAGAAGGGAAGGCTGACGGCGGAGACCTCGCGCA
GCGGTGAGACAACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGAT
GGGCAGTACAAAACAGATGGCATGGAGCCGTTACGGTCAACTGCTGGCCTTTACGGACTGCTCGGGGTAC
ACGACGCGGTATGAGTACGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAAGAAGGCATCAGCACTT
ACAGCAGTTATAACCCGCGTGGGCAAATGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCCTTATGA
GTACAGCGCCGCAGGAGACCTGACAGCAACGGTATCACCGGACGGTAAACGCAGCACCATCGCATATGAT
AAACGCGGGCGTCCGGTGAGTGTGACGGAAGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGC
GCATCACCGTGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTTGACAGGCTGAC
TGAACAGCGCGGTTTTGACGGCCGGACGCAACGTTACCACTATGACCTGACCAGAAAACTCACACAGAGT
GAAGACGAGGGGCTTATCACCCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACG
GCGACCCGGCAGAGCAGTGGCAGTATGATGAGCACGGGTGGTTAACCACCCTCAGCCATACCAGTGAAGG
CCACCGCGTGTCGGTCCACTACGGCTACGACGATAAGGGCCGCCTGACGGGCGAACGGCAGACGGTGGAG
AACCCGGAGACGGGGGAACTGCTGTGGCAGCATGAGACGAAACACGCCTACAACGAACAGGGGCTGGCAA
ACCGCGTCACGCCGGACAGCCTGCCGCCGGTGGAGTGGCTGACCTACGGCAGCGGTTACCTGGCGGGCAT
GAAGCTGGGCGGGACGCCGCTGGTCGAGTATACGCGGGACAGGCTGCACCGTGAGACGGTGCGCAGCTTC
GGCAGCAGGGCAGGCAGTAATGCCGCATATGAACTGACCAGCACATACACCCCCGCAGGCCAGTTACAGA
GCCAGCACCTGAACAGCCTGGTGTATGACCGTGACTACGGGTGGAATGACAACGGCGACCTGGTGCGCAT
CAGCGGTCCGCGACAGACGCGGGAATACGGCTACAGTGCCACGGGCAGGCTGGAGAGCGTGCGCACCCTC
GCACCGGACCTGGACATCCGCATCCCGTATGCCACCGACCCGGCGGGAAACCGCCTGCCGGACCCGGAGC
TACACCCGGACAGCACGCTCACGGCGTGGCCGGATAACCGCATCGCAGAGGATGCGCACTATGTTTACCA
CTATGATGAATACGGCAGACTGACGGAGAAGACGGACCGCATCCCGACGGGTGTGATACGGACGGACGAC
GAGCGGACCCACCACTACCACTACGACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCATGGCG
AGCCACTGGTCGAGAGCCGCTACCTCTACGACCCGCTGGGACGGCGAATGGCGAAACGGGTATGGCGGCG
GGAGCGTGACCTGACGGGGTGGATGTCGCTGTCGCGTAAACCGGAGGAGACATGGTACGGCTGGGACGGC
GACAGGCTGACGACGGTACAGACCGACACCACGCGTATCCAGACGGTATACCAGCCGGGGAGCTTCGCGC
CGCTCATCCGCATCGAAACAGACAACGGTGAACGGGAGAAAGCGCAGTGCCGCAGCCTGGCGGAGAAGAT
ACAGCAGGAAGGGAGCGAAGACGGTCACGGTGTGGTGTTCCCGGCTGAACTGGTGGGGCTGCTGGACAGG
CTGGAGGGGGAAATCCGGGCAAACTGCGTGAGCAGTGAAAGCCGCCAGTGGCTTGCGCAGTGCGGGCTGA
CGGTGGAGCGGCTGGCGGCACAGATAGAGCCGGTTTATTTGCCTGAGCGAAAAATACATCTTTATCACTG
TGACCACCGGGGCCTGCCGCTGGCGCTTATCAGTGAAGACGGCAATACGGCGTGGAGCGCGGAATATGAT
GAATGGGGCAACCAGCTTAATGAGGAGAACCCGCATCACCTGCACCAGCCGTACCGGATGCCGGGGCAGC
AGTATGATAAGGAGTCGGGGCTGTACTATAACCGTCACCGGTACTACGATCCGTTGCAGGGGCGGTATAT
CACCCCGGACCCGATTGGGTTGAGAGGTGGATGGAATATGTATCAGTATCCGTTGAATCCCATACAAGTG
ATAGACCCAATGGGGTTAGATGCGATTGAGAATATGACATCAGGTGGACTAATTTATGCCGTATCTGGTG
TACCTGGATTGATTGCTGCAAACAGCATTACTAACAGTGCTTACCAGTTCGGTTATGATATGGATGCTAT
TGTTGGCGGAGCTCATAATGGGGCCGCCGATGCAATGAGACATTGTTACTTGATGTGTCGAATGACTAAG
ACATTTGGATCAACAATAGCTGACGTGATAGGTAAAAATCATGAGGCGGCAGGGGATAGACAAGGTCAGC
CAGCTAAAGAAAGAATCATGGATCTTAAAAATAACACTGTCGGTATTGCTTGTGGCGATTTTTCTGCCAA
ATGTAGCGATGCATGTATTGAAAAATATAACACTGGGCAACTCTTCGGGTTAGATGGTATAAAAGCAGAT
AATCCAATAAAAGCAAAGCAAGGGAGTTCAGATGCTTCAAATTATTAG