SecReT6
Protein ID: 157158774
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3134
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3141685..3142113 [+]
Producthypothetical protein
NoteTssE
UniProt IDA7ZQS0
KEGG IDecw:EcE24377A_3134
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-16, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|157158774|ref|YP_001464149.1| hypothetical protein EcE24377A_3134 [Escherichia coli E24377A]
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3141685-3142113 Escherichia coli E24377A chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTGTTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA