SecReT6
Protein ID: 157159137
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0235
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]254884..256164 [-]
Producthypothetical protein
NoteFha
UniProt IDA7ZHW5
KEGG IDecw:EcE24377A_0235
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0099, Aligned region: 35..100
Protein Sequence: 426 a.a.     [Download]
>gi|157159137|ref|YP_001461394.1| hypothetical protein EcE24377A_0235 [Escherichia coli E24377A]
MPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQHSIPAQAFTIILHDGTFCLRP
QTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLST
EGTPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMD
LPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKGLLDLQQQ
RNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRV
LLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c256164-254884 Escherichia coli E24377A chromosome, complete genome
ATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCAGTGAGCTGGAAAGCGGGCGGG
CGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGCCCCCGAATGCCACTGGTCGGTACAGGA
TCGTCAGCATAGCATTCCGGCCCAGGCTTTTACCATTATCCTGCACGATGGCACATTTTGTCTGCGCCCG
CAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAGACCTAATACAGTTGCGCCAGG
GCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTCCCCATTACGA
TGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCTGCTATCAACG
GAGGGTACGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTAAACGGTTTTT
CTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTTCAGGCATTGC
GGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCCGTTTATGGAT
CTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTGCGGCAGAAATGGCGCAACGCC
ACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCATGAGCAATTCCGACGATGCGGA
TGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTTGCAGCAGCAG
CGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAACATGGATTACG
CCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCGCCGCCGTCAG
TGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCGATTGTGGAGTCGCTTCGTGTC
CTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGCCATGAACTGC
GCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGGCCTCCGATCG
CCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTATGACCGGGTGCTTCGTGAAAAA
CAGCGGGAGCCGGAAGCATGA