SecReT6
Protein ID: 157159449
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3133
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3141298..3141681 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDA7ZQR9
KEGG IDecw:EcE24377A_3133
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-27, Aligned region: 8..117
Protein Sequence: 127 a.a.     [Download]
>gi|157159449|ref|YP_001464148.1| type VI secretion lipoprotein [Escherichia coli E24377A]
MNWQKTARNTDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNV
PLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 384 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3141298-3141681 Escherichia coli E24377A chromosome, complete genome
ATGAACTGGCAAAAAACGGCCCGCAATACGGATGCGGAAGATACGCCGCTTTCCACGATGGTGCATGTCT
GGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTATGACACCCTGTTTATGCAGGAAGAGAAGAC
GCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGCATCCCTGAATGTG
CCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGATGAAAAAAGCGACA
GCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTGAACTGATGAGAAG
CGACCTGCGACTGCTGCCTCTCAAGGATAAATAA