SecReT6
Protein ID: 157159685
SecReT6 ID230
T6SS typei1
Gene symbolclpV
Locus tagEcHS_A0229
StrainEscherichia coli HS
Repliconchromosome [GenBank: NC_009800] [Browse all T6SS(s) in this replicon]
Location [Strand]246871..249642 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA7ZWG6
KEGG IDecx:EcHS_A0229
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-38, Aligned region: 646..807
AAA [PF00004], Evalue: 8.30E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 8.30E-17, Aligned region: 652..769
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 651..771
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 813..890
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 265..300
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 622..692
AAA_16 [PF13191], Evalue: 5.10E-11, Aligned region: 717..745
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 650..685
AAA_29 [PF13555], Evalue: 4.60E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 4.60E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 4.60E-05, Aligned region: 649..676
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 646..680
AAA_25 [PF13481], Evalue: 5.40E-05, Aligned region: 779..843
NACHT [PF05729], Evalue: 8.10E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 8.10E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 8.10E-05, Aligned region: 453..453
NACHT [PF05729], Evalue: 8.10E-05, Aligned region: 652..680
NACHT [PF05729], Evalue: 8.10E-05, Aligned region: 858..881
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.00E-05, Aligned region: 651..741
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 645..673
DUF258 [PF03193], Evalue: 0.00033, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00033, Aligned region: 652..670
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0047, Aligned region: 652..687
AAA_17 [PF13207], Evalue: 0.0096, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0096, Aligned region: 652..686
Protein Sequence: 923 a.a.     [Download]
>gi|157159685|ref|YP_001457003.1| type VI secretion ATPase [Escherichia coli HS]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDAADTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGHVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESEQDNTGAEPADEAGSEQPKETAETVSPVQRL
AHLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASL
HKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSP
PGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNL
GYQVIVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAE
VIIEPEVTDEIMSRVTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGAFTADVEDA
QNDESVTKDETVL
 
Nucleotide Sequence: 2772 bp     [Download]
>gi|157159467|ref|NC_009800.1|:c249642-246871 Escherichia coli HS, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTTAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTGGAGAACTACACAACTGCCCGTTCTGCGGACAGCTACCCGGCATTTTCCCCGATGCTGGTTG
AGTGGCTGAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAATTGCGTGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAATGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCTGCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGCAAGAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCCT
TAATCGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCATGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACTTGGGCGCATTGCAGGCCGGAGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATTGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGCAGGATAATACCGGTGCCGA
ACCGGCTGATGAAGCTGGCAGCGAACAGCCGAAAGAGACCGCTGAAACAGTTTCCCCGGTACAACGTCTG
GCACATCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTTTCCCCGCACGTCGATAAAA
AACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTTAACCGCCTGTCGCAGAATGAAATGTC
GGTCATCACCGACCTGCCAAAATGGCTCGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTG
CACAAACACCTGCTGACCGCACGCGCCGACCTGCGCCGTCCGGGACGCCCGCTGGGCGCGTTCCTGCTGG
CTGGCCCCAGCGGCGTGGGTAAAACTGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCA
GTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACATACCGTCTCGCGACTGATTGGTTCGCCT
CCGGGCTACGTTGGCTACGGTGAAGGCGGCGTACTGACCGAAGCGATTCGCCAGAAACCCTACTCGGTAG
TACTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGG
CGAAATGGCAGACGGTGAAGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTC
GGCTACCAGGTAATAGTCGAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGG
CCGACTTCTTCAAACCTGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTACCTGCCGCTGTCGAAAGAGAC
GCTCGCCACCATCATTGCCGGGAAACTGGCCCGCCTGGATAACGTGCTGCGCAGCCGCTTTGGCGCGGAG
GTGATTATAGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGA
TGCTGGAATCGGTCATCGACGGCAATATGCTGCCGCCGCTCTCCCTGCTGCTGTTGCAGAAAATGGCGGC
GAATACGGCGGTTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAAGATGCT
CAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA