SecReT6
Protein ID: 157159687
SecReT6 ID230
T6SS typei1
Gene symbol-
Locus tagEcHS_A0231
StrainEscherichia coli HS
Repliconchromosome [GenBank: NC_009800] [Browse all T6SS(s) in this replicon]
Location [Strand]250417..251748 [-]
Producthypothetical protein
NoteTssK
UniProt IDA7ZWG8
KEGG IDecx:EcHS_A0231
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|157159687|ref|YP_001457005.1| hypothetical protein EcHS_A0231 [Escherichia coli HS]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNNLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQHFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
TRTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|157159467|ref|NC_009800.1|:c251748-250417 Escherichia coli HS, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGTCCACACCATTTCCAGCAGC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATAATTTATCCTGGGGATTTAC
CGAACTCACTCTCAACAATGAACTGCTGGCACAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAACATTTTC
CGGACGAGAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
ACGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGTGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGCATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCGCGCTCGTCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACGCTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCCGTTAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCTGTGGCGGCA
AACATGCCGGTCGATCAGATCCAGCGCCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATACCCGGCATTCCATTGCGTGCCCTGATGGTGGCTCCCCGCCAGCTTCC
TTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGACAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA