SecReT6
Protein ID: 157159695
SecReT6 ID230
T6SS typei1
Gene symbol-
Locus tagEcHS_A0239
StrainEscherichia coli HS
Repliconchromosome [GenBank: NC_009800] [Browse all T6SS(s) in this replicon]
Location [Strand]258682..259182 [-]
Producthypothetical protein
NoteTssB
UniProt IDA7ZWH6
KEGG IDecx:EcHS_A0239
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|157159695|ref|YP_001457013.1| hypothetical protein EcHS_A0239 [Escherichia coli HS]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSPLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|157159467|ref|NC_009800.1|:c259182-258682 Escherichia coli HS, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCCCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACGCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA