SecReT6
Protein ID: 157159699
SecReT6 ID230
T6SS typei1
Gene symbol-
Locus tagEcHS_A0243
StrainEscherichia coli HS
Repliconchromosome [GenBank: NC_009800] [Browse all T6SS(s) in this replicon]
Location [Strand]260607..262748 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDA7ZWI0
KEGG IDecx:EcHS_A0243
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-62, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 2.90E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|157159699|ref|YP_001457017.1| type VI secretion system Vgr family protein [Escherichia coli HS]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYLTIWQGDDVQR
RVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILGTILQENGVTEWSPMFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASDLHGEQPQAVPGRRGSGTTLDNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQESSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|157159467|ref|NC_009800.1|:260607-262748 Escherichia coli HS, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTTTTTTCCCTCGATCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTCCAGCAGATCCTCGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTATGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTGTGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGATGTTCAGCGAGCCACAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTGAGCACCCTCTGC
ATCAGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGTGCCCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCGCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCGAGCGATCTTCACGGCGAACA
GCCGCAGGCGGTACCGGGACGCAGGGGTTCAGGCACCACGCTGGATAACCACTTTGCGGTAATCCCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGAAAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGCTTTGGT
AACCTGGCGATACCGCGTGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TCATTATGGGGCGTACCTACCACCAGGAAAACCGCACCCCCGGCAGCCTGCCGGGGACGAAGACGCAGAT
GACGATCCGCTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACTGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTGGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGA
CGGTAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTGGGGAATAACGTCACCTTCTCGGTGGGCAAGACAATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTCAATGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA