SecReT6
Protein ID: 157163890
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1178
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]134253..135611 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDA7ZBA9
KEGG IDcco:CCC13826_1178
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.90E-121, Aligned region: 7..451
Protein Sequence: 452 a.a.     [Download]
>gi|157163890|ref|YP_001466067.1| type VI secretion protein [Campylobacter concisus 13826]
MNVDKVHFEQQERYFERNLNLKTVSSFSNLYGVLELEISSELLLQGKIGLNKISCISQDGTIYNAPDQDD
LPEPLEISPSELNSAVIVLKLPVSSGLVDVSLQNNLPNLKFTAKQALISSRVHDEASNDILNELDDKYDF
ELSSAFTQDKENLILASQRSTLGVLGSKTPYELSVPVCRIKNIDLNKQITLDEKFIPTCIDVSKNSFITS
FIDEFSFATKQHQESYTGLLGGIDQAKNRLDISTYLTLNMLKKWHLIFSYLFKRDKIHPEYLYEKLIDFQ
ADLLALSHDDSFSEFIAYDHNNLSQTFVPLINNLRLLFSHILSPKYVMAQIVKNNHGFFDCVFDNPSIIE
NSEIYFAIHSDTKNEYLLKNFKEQCKIHTQSNIKSIVSSQLRGINVEQISAIPSTLPKLNDYIYYKIDKK
DEIFKSFANQSVISVYITANLSNADIKMWALL
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|157163852|ref|NC_009802.1|:134253-135611 Campylobacter concisus 13826, complete genome
ATGAACGTTGATAAAGTTCATTTCGAGCAGCAAGAGAGGTATTTTGAGAGAAATTTAAACCTAAAAACCG
TCTCGTCTTTTTCAAATTTATATGGAGTTTTGGAGCTTGAGATCTCAAGCGAGCTTTTGCTTCAAGGCAA
GATAGGGCTAAATAAAATTTCTTGTATCTCGCAAGATGGTACGATATATAACGCCCCAGATCAAGACGAC
CTACCAGAGCCTCTTGAGATAAGCCCTAGCGAGCTAAATTCTGCTGTCATAGTGCTAAAGCTACCAGTTA
GCTCAGGACTTGTTGATGTTAGCTTGCAAAACAACCTGCCAAATCTAAAATTTACAGCTAAACAAGCGCT
CATTAGCTCAAGAGTGCATGATGAAGCTAGCAACGATATCTTGAACGAGCTAGATGACAAATACGACTTT
GAGCTTTCATCTGCTTTTACGCAGGATAAAGAAAATTTGATCCTAGCAAGTCAAAGATCGACTCTAGGAG
TGCTTGGCTCAAAAACGCCTTATGAGCTTAGCGTGCCTGTTTGCAGGATAAAAAACATAGATCTAAACAA
ACAAATAACGCTCGATGAGAAATTTATACCAACTTGCATTGATGTCAGTAAAAATTCTTTCATCACTAGC
TTTATAGATGAGTTTAGCTTTGCTACAAAGCAGCATCAAGAGAGCTACACTGGGCTTTTAGGCGGTATAG
ATCAGGCTAAAAATAGGCTTGATATTTCAACATATTTGACGCTAAATATGCTTAAAAAATGGCACTTGAT
ATTCTCCTATCTTTTTAAAAGAGACAAAATTCATCCAGAGTATCTATATGAAAAGCTAATTGATTTTCAA
GCTGATCTGCTAGCTCTAAGTCACGATGATAGTTTTAGCGAATTTATAGCTTATGATCACAACAACTTAA
GTCAAACTTTTGTACCGCTAATAAACAATCTTAGGCTTTTGTTCTCGCATATCTTGTCGCCAAAATACGT
CATGGCACAGATCGTTAAAAACAATCACGGCTTTTTTGACTGCGTCTTTGATAATCCAAGCATCATAGAA
AACTCAGAAATTTACTTTGCTATCCATAGCGATACAAAAAATGAGTACCTGCTCAAAAATTTCAAAGAAC
AGTGCAAAATTCACACCCAATCAAACATCAAAAGTATCGTCTCATCACAGCTTCGCGGCATAAATGTAGA
GCAAATTTCAGCTATACCTAGTACATTGCCAAAGCTAAATGACTATATCTACTACAAGATCGATAAAAAA
GATGAAATTTTTAAAAGCTTCGCAAATCAAAGCGTTATTAGCGTCTATATAACAGCAAATTTATCAAACG
CTGACATTAAGATGTGGGCTTTATTATAA