SecReT6
Protein ID: 157164561
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1181
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]137747..138232 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDA7ZBB2
KEGG IDcco:CCC13826_1181
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.50E-53, Aligned region: 6..156
Protein Sequence: 161 a.a.     [Download]
>gi|157164561|ref|YP_001466070.1| type VI secretion protein [Campylobacter concisus 13826]
MAENSIPPKERINIVYRTKTNNQEADVELPLKLMVVSNLTGENQTPLEDREVVSINKINFDQVMKSLDIH
TEFSVKNRLNSGSEDLNIDLNFESIQDFNPDNIINQVPELKKLLQLRKALVALKGPMGNMPDFRKAVLEA
IKDEDSRKQLLLELKDEKDKE
 
Nucleotide Sequence: 486 bp     [Download]
>gi|157163852|ref|NC_009802.1|:137747-138232 Campylobacter concisus 13826, complete genome
ATGGCAGAGAATTCAATCCCACCAAAAGAACGTATAAACATTGTTTATAGAACAAAAACAAACAACCAAG
AAGCAGATGTTGAGCTTCCGTTAAAGCTGATGGTAGTTTCAAATTTAACTGGTGAAAACCAAACTCCACT
TGAAGATCGCGAAGTTGTCTCTATAAATAAGATAAATTTCGATCAGGTTATGAAAAGTTTGGACATTCAT
ACTGAATTTTCAGTGAAAAATAGACTAAATTCTGGTAGCGAAGATCTAAATATCGATCTTAACTTTGAAA
GCATTCAAGATTTCAATCCAGACAATATCATCAACCAAGTACCTGAGCTAAAAAAGCTATTGCAGCTTAG
AAAAGCTTTAGTTGCATTAAAAGGACCTATGGGCAATATGCCTGATTTTAGAAAAGCAGTTTTAGAGGCT
ATTAAGGATGAAGATAGTAGAAAACAGCTTCTTTTAGAGCTTAAAGACGAAAAAGATAAGGAATAA