SecReT6
Protein ID: 157165049
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1195
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]151440..154022 [+]
Productribosomal protein L7/L12
NoteTssI
UniProt IDA7ZBC2
KEGG IDcco:CCC13826_1195
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-23, Aligned region: 128..345
Phage_base_V [PF04717], Evalue: 2.30E-15, Aligned region: 503..590
Protein Sequence: 860 a.a.     [Download]
>gi|157165049|ref|YP_001466080.1| ribosomal protein L7/L12 [Campylobacter concisus 13826]
MKQQENVKNFIESLKINRNKRIKEETMDKNITSPTSSLTKPVMLASSNSVATDGFVDYGVSSDAFSTLQI
ANEANDKFIVTRADINESLEDIFNIECFAYINLVKNPLYENLESIYNDNAQTGIYRYLDKGMKLSIKRPS
STNKSIIPSNNGSDYIYFSGIVSDVEYLGVDDDSSTNIDKKYFFKFKLTSSLYRLSINRANRIYTDQSVL
EVVKEILSFNKQRLTKELDFSNIKNSYNKKEFIAQYNESDLAFITRLCHDSGIYFYEDNEKIYFHDTFIL
AYSNQAEGLAQSEPSKGKEARKVSFNVNLNNNLASEHINKITKSETLKANSFTHSFQNTAYPNVLESKNE
KIFDEQVNIYDKHINLDEYSFSDTRLLEVSTYLKKLRSDMLLKEFVASSNVFALNLNDNISVAIDQSSGE
YEFKIIAIKHTYIDESVLENTLNLGDNVPLKDKKFISSYTNELSIIPSSVKFVPSYKQKPKAPDITLGLV
VGQDGLNSQTNTIHTDSYGRVKVRLNAFSTQEQIDKDDTINASYHKSAYLRVITPIASNSSGFFAIPRVG
DEVIISFLQNDIDNPVVSGSLYNASNMPLVNVDNNYHQTSLSSKTIGANETGINEITLSNLKNKEQIYVK
AEKDYDELVNNDFSQTILNDKSSQVHGSYTERVKKAHIQTIDLAKNVNVGGEYLTTVGLSKDTVVGVSNT
LNVAVDDTTRVGQDRHEFVGNDKFVEIKSNLNTTIHNDETKEIKGTKEQNIDGSYKLNSQKGINEFSNEH
IVLQANNYIDINAKSNLTTKTAAQHTEMADSKYSEIETTYEVNAKNEIIHQVESTKVTINGSSVVIEVGG
IKAIFDSMGLRVIGGDIKAL
 
Nucleotide Sequence: 2583 bp     [Download]
>gi|157163852|ref|NC_009802.1|:151440-154022 Campylobacter concisus 13826, complete genome
TTGAAGCAACAAGAAAATGTTAAAAATTTTATAGAATCATTAAAAATAAATAGAAACAAAAGGATAAAAG
AGGAAACTATGGACAAAAATATAACATCACCAACATCATCACTAACTAAGCCAGTCATGCTAGCATCTAG
CAACTCGGTGGCAACAGACGGCTTTGTAGATTATGGCGTATCTAGCGATGCCTTCTCAACTCTTCAGATA
GCAAATGAAGCAAATGACAAATTTATAGTCACAAGGGCTGATATAAATGAGAGTTTAGAAGATATATTTA
ACATAGAGTGCTTTGCCTATATAAATTTAGTCAAAAATCCGCTTTATGAAAATTTAGAGAGCATATATAA
CGATAACGCTCAAACTGGCATATATAGGTACCTTGATAAAGGCATGAAGCTAAGTATAAAAAGACCGTCT
TCTACAAACAAGAGTATCATCCCAAGCAATAATGGCAGCGACTATATCTACTTTAGCGGCATAGTAAGCG
ATGTCGAGTATCTGGGCGTTGATGATGACAGCAGCACAAATATAGACAAAAAATATTTCTTCAAATTTAA
ACTCACATCCTCGCTATATAGACTAAGTATAAATAGAGCAAATAGAATTTACACAGATCAAAGCGTGCTT
GAAGTAGTAAAAGAAATTTTGTCTTTTAACAAGCAAAGGCTAACCAAAGAGCTAGACTTCTCAAACATCA
AAAATAGCTACAATAAAAAAGAATTTATAGCGCAGTATAACGAAAGCGACCTAGCCTTTATAACAAGACT
TTGCCATGATAGCGGTATATATTTTTACGAAGATAATGAGAAAATTTACTTTCACGATACCTTTATCCTG
GCTTATAGCAACCAAGCTGAAGGCCTAGCACAGAGCGAACCGAGTAAAGGCAAAGAGGCTAGAAAAGTAA
GCTTTAATGTAAATTTAAATAACAATCTTGCAAGCGAACATATAAATAAAATCACAAAGAGCGAAACTCT
AAAAGCAAATAGCTTTACCCACTCATTTCAAAACACAGCCTATCCAAACGTGCTAGAGAGCAAAAATGAG
AAGATATTTGACGAGCAGGTAAATATCTATGATAAGCATATAAATTTAGATGAGTATTCATTTAGTGATA
CGAGGTTGCTTGAAGTCAGCACCTATCTTAAAAAGCTAAGAAGTGATATGCTATTGAAAGAATTTGTCGC
TAGCTCAAATGTCTTTGCTCTAAATTTAAATGACAATATCTCAGTCGCCATAGATCAAAGTAGCGGCGAG
TATGAGTTTAAAATAATAGCTATAAAACACACTTATATAGACGAAAGTGTCTTAGAAAATACTCTAAATT
TAGGCGACAATGTCCCTTTAAAAGATAAGAAATTTATAAGCTCATATACAAATGAGCTAAGCATCATCCC
AAGCAGTGTGAAATTTGTACCAAGCTACAAGCAAAAGCCAAAAGCGCCTGACATCACTCTAGGTCTTGTT
GTAGGACAAGATGGGCTAAACAGCCAAACAAACACCATCCATACAGACAGTTACGGCAGAGTAAAGGTAA
GACTAAACGCCTTTAGCACGCAAGAGCAGATAGATAAAGACGACACCATAAACGCAAGCTATCATAAAAG
TGCCTATCTAAGAGTGATCACGCCGATAGCTAGCAACAGCTCTGGCTTCTTTGCGATACCTAGGGTCGGC
GACGAGGTGATCATCTCATTTTTGCAAAACGACATAGACAACCCAGTGGTAAGCGGCAGCCTCTATAATG
CCTCAAATATGCCACTAGTAAATGTAGATAACAACTACCACCAAACATCGCTTAGCTCAAAAACAATCGG
TGCAAACGAGACCGGCATAAACGAGATCACTTTGTCAAACCTAAAAAACAAAGAGCAAATTTATGTAAAA
GCTGAGAAAGACTACGACGAGCTAGTAAATAACGACTTTTCTCAAACGATACTAAATGACAAAAGCTCTC
AAGTGCATGGTAGCTACACCGAAAGGGTCAAAAAAGCGCACATCCAAACGATAGACCTTGCTAAAAACGT
AAATGTCGGTGGCGAGTATCTAACGACGGTTGGACTTTCAAAAGATACGGTAGTAGGCGTCTCAAATACA
CTAAATGTAGCTGTTGATGATACAACTAGAGTTGGTCAAGATAGACATGAGTTTGTCGGCAATGACAAAT
TTGTCGAGATAAAATCAAACCTCAACACAACCATACACAACGACGAAACCAAAGAGATAAAAGGTACTAA
AGAGCAAAACATAGATGGTAGCTACAAGCTAAATTCGCAAAAAGGCATAAATGAGTTTAGTAACGAGCAC
ATCGTGCTTCAGGCAAACAACTATATCGACATAAACGCCAAGTCAAATCTCACGACAAAGACAGCCGCAC
AGCATACCGAGATGGCGGACTCAAAATATAGCGAGATCGAGACGACATACGAAGTCAATGCTAAAAATGA
GATCATACACCAAGTAGAGAGCACAAAAGTAACGATAAATGGCTCAAGCGTGGTTATAGAAGTTGGCGGC
ATAAAAGCGATATTTGACAGCATGGGACTAAGAGTCATCGGCGGAGATATAAAGGCACTGTAA