SecReT6
Protein ID: 157165082
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1179
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]135621..136385 [+]
Productaspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B)
NoteTssL
UniProt IDA7ZBB0
KEGG IDcco:CCC13826_1179
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-42, Aligned region: 22..232
60KD_IMP [PF02096], Evalue: 0.004, Aligned region: 28..239
Protein Sequence: 254 a.a.     [Download]
>gi|157165082|ref|YP_001466068.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B) [Campylobacter concisus 13826]
MSENQNEISALSQTKLLGLGANPALDHVLPLLLLANRVSKLQNFSQSEMQNLREKLINDILSTTSKISNL
GIYEEDDIIRLRYCLCVFIDESLLKNEIFMNSFWANNTLTTRFFNENLGGNKFFGIMDKWFENVGKNKDF
LEFIYACLVLGYKGKYEAQEDCNEKISYLCENIASAVSPLIKADENVFEKSYLKTKKRSFFEIFSLRHLK
FYFILIALAAIAAAFLYSTYSMDQNNVKNDSVLNNKIENFMDKK
 
Nucleotide Sequence: 765 bp     [Download]
>gi|157163852|ref|NC_009802.1|:135621-136385 Campylobacter concisus 13826, complete genome
ATGAGTGAGAATCAAAATGAAATTTCGGCTTTAAGCCAGACAAAGCTTCTAGGACTTGGTGCAAATCCTG
CCCTAGATCACGTGCTACCACTGCTTCTTTTAGCAAACAGAGTATCAAAACTACAAAATTTTTCACAAAG
TGAGATGCAAAATTTACGTGAAAAGCTGATAAATGATATATTAAGCACCACTTCAAAGATCTCAAATTTA
GGCATTTATGAAGAGGACGACATCATTAGGCTTAGATATTGCCTTTGTGTTTTCATCGATGAGAGCTTGC
TTAAAAATGAAATTTTTATGAACAGTTTTTGGGCGAACAACACCTTAACAACGAGATTTTTCAACGAAAA
TTTAGGTGGCAACAAATTCTTTGGCATAATGGATAAATGGTTTGAAAATGTTGGCAAAAACAAGGACTTT
TTAGAGTTTATCTACGCTTGTTTGGTGCTTGGCTACAAGGGCAAATACGAAGCGCAGGAAGATTGCAATG
AGAAAATTTCATACCTTTGTGAAAATATAGCCTCAGCCGTTTCGCCACTTATCAAAGCTGATGAAAATGT
ATTTGAAAAGAGCTATTTAAAAACTAAAAAGAGAAGCTTTTTTGAGATATTTTCACTAAGACATTTGAAA
TTTTATTTTATCCTTATAGCGCTTGCAGCTATCGCGGCTGCGTTTTTATATAGCACTTACTCGATGGATC
AAAACAACGTTAAAAACGACAGCGTCTTAAACAATAAGATAGAAAATTTTATGGACAAAAAGTAA