SecReT6
Protein ID: 157165098
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1188
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]147250..147771 [+]
Productsecreted protein Hcp
NoteTssD
UniProt IDA7ZBB6
KEGG IDcco:CCC13826_1188
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.00E-37, Aligned region: 6..155
Protein Sequence: 173 a.a.     [Download]
>gi|157165098|ref|YP_001466074.1| secreted protein Hcp [Campylobacter concisus 13826]
MSQPVYIKVKGSTQGLISSGASTEASIGNRYQSGHEDEIMAQEVSHIVTVPVDPQSGQPSGQRVHKPFSF
TTSLNKAVPLLYNALTQGERLPEVEIHWYRTSTSGGAEHFFTTKLEDATITDITLVSPNAQDKLNSDKTE
LFKVSMNYRKIVWEHVAAGTSGSDDWREATKKA
 
Nucleotide Sequence: 522 bp     [Download]
>gi|157163852|ref|NC_009802.1|:147250-147771 Campylobacter concisus 13826, complete genome
ATGTCACAACCAGTGTATATTAAGGTGAAAGGTTCTACTCAAGGACTTATCTCAAGTGGTGCTTCAACAG
AAGCTAGTATCGGCAATCGCTATCAGTCAGGTCACGAAGATGAGATCATGGCACAAGAGGTTTCTCACAT
CGTAACTGTTCCAGTGGATCCACAAAGTGGCCAACCATCAGGACAAAGAGTACATAAGCCATTTAGCTTT
ACAACATCTTTAAATAAAGCTGTTCCACTTCTTTACAATGCACTAACTCAAGGCGAGAGACTTCCAGAGG
TTGAGATCCACTGGTACAGAACATCAACTAGCGGTGGCGCTGAGCACTTCTTCACTACAAAACTAGAAGA
TGCAACTATAACAGATATCACTCTAGTAAGTCCAAATGCTCAAGACAAGCTAAACAGCGACAAAACTGAG
CTTTTCAAAGTTTCAATGAACTATAGAAAGATAGTTTGGGAGCACGTAGCTGCAGGCACAAGCGGAAGCG
ATGACTGGAGAGAAGCTACTAAAAAAGCTTAA