SecReT6
Protein ID: 157165409
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1177
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]133748..134215 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDA7ZBA8
KEGG IDcco:CCC13826_1177
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.20E-17, Aligned region: 23..141
Protein Sequence: 155 a.a.     [Download]
>gi|157165409|ref|YP_001466066.1| type VI secretion lipoprotein [Campylobacter concisus 13826]
MKKTFKFLCYLIFMLFVAGCAKDLIISNTPNSNLNYHGDNVPVTIIAYKLRDVAKFQQASIVDLAEKNGD
ILGQDKIDSIKTQIQPNTNRYAFTNVDPDEVPYVGILVLYADQSKTNIKAYKSTKEAKEKNIVFEITKNG
VNTIDASGSKIQASK
 
Nucleotide Sequence: 468 bp     [Download]
>gi|157163852|ref|NC_009802.1|:133748-134215 Campylobacter concisus 13826, complete genome
ATGAAGAAAACGTTTAAATTTCTTTGTTATTTAATTTTTATGCTATTTGTCGCAGGATGTGCAAAAGATC
TTATCATAAGCAACACTCCAAATTCAAACTTAAACTACCACGGTGACAACGTTCCAGTGACTATCATCGC
TTATAAGCTAAGAGATGTGGCAAAATTTCAGCAAGCTAGCATAGTTGATCTAGCTGAGAAAAATGGCGAC
ATACTTGGTCAAGACAAGATAGACTCGATAAAAACGCAAATTCAGCCAAATACAAACAGATACGCTTTTA
CAAATGTCGATCCAGACGAAGTACCATACGTAGGCATTTTGGTGCTTTATGCTGATCAAAGCAAGACAAA
TATCAAAGCTTACAAATCAACAAAAGAAGCAAAAGAGAAAAATATAGTTTTTGAGATAACTAAAAATGGC
GTAAATACCATAGACGCCAGCGGCTCTAAGATCCAAGCAAGCAAATAA