SecReT6
Protein ID: 157165630
SecReT6 ID481
T6SS typei1
Gene symbol-
Locus tagCCC13826_1187
StrainCampylobacter concisus 13826
Repliconchromosome [GenBank: NC_009802] [Browse all T6SS(s) in this replicon]
Location [Strand]146268..147185 [+]
Producthypothetical protein
NoteFha
UniProt IDA7ZBB5
KEGG IDcco:CCC13826_1187
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 305 a.a.     [Download]
>gi|157165630|ref|YP_001466073.1| hypothetical protein CCC13826_1187 [Campylobacter concisus 13826]
MQEIAAVIQNFDKASSFLAQYVIFDENGGDIGSLDTVKFPCSDTSGSIASKHAHIGFEEGVFTICGYEGC
EIFYSDSYSKLPDDYESVINPGDIFRIGELKFIFIDPSRIDEYVGKAHKIIENTKNFDELDNKEFEPVGK
ISNVDFKEEPKINSLIDEEKDITLNENVNDVPLNLNESAQNLDEEDINSQRMLTAKSMDELLMNLVESIK
VQPNMSPISEQSRTLNTKDMETIIKTLPLSDNTTLVNAVLLKLICKELYSQMYDIVENNSFFKYLSGAVT
KSTREDKEAFNYLLHKALESYMLKK
 
Nucleotide Sequence: 918 bp     [Download]
>gi|157163852|ref|NC_009802.1|:146268-147185 Campylobacter concisus 13826, complete genome
ATGCAAGAAATAGCAGCGGTTATACAAAATTTTGATAAAGCTTCGAGCTTTTTGGCGCAGTATGTCATTT
TTGATGAAAACGGCGGGGACATAGGCTCGCTAGATACGGTTAAATTTCCTTGCAGTGATACAAGTGGCTC
TATAGCTTCAAAGCACGCTCATATAGGCTTTGAAGAGGGCGTTTTTACCATTTGCGGATACGAAGGATGC
GAGATATTTTATAGCGATTCTTATTCGAAGTTACCTGATGATTATGAAAGTGTGATAAACCCAGGAGATA
TTTTTAGGATAGGAGAGCTTAAATTTATATTTATAGATCCTTCTAGGATAGACGAATATGTCGGCAAAGC
TCACAAGATCATAGAAAATACCAAAAATTTTGATGAGCTTGATAATAAAGAATTTGAGCCAGTTGGAAAA
ATCTCAAATGTTGATTTTAAAGAAGAGCCAAAGATAAATTCTCTCATAGATGAAGAAAAAGATATCACTT
TAAATGAAAATGTTAATGATGTACCTTTAAATTTAAATGAGAGCGCTCAAAATTTAGATGAAGAAGATAT
AAATAGTCAAAGAATGCTAACAGCAAAGAGCATGGATGAGCTTTTGATGAATTTGGTTGAGAGCATAAAA
GTGCAGCCAAACATGAGCCCTATAAGCGAGCAGAGCAGGACATTAAATACAAAAGATATGGAAACTATTA
TAAAAACGCTGCCTCTAAGCGACAACACGACGCTTGTTAATGCTGTTTTGCTTAAGCTTATATGCAAGGA
GCTATATAGTCAAATGTACGATATAGTCGAGAATAATTCATTTTTCAAATATCTCTCTGGTGCTGTAACA
AAAAGCACTAGAGAAGATAAAGAGGCGTTTAATTATTTATTACATAAAGCACTTGAAAGCTATATGTTAA
AAAAGTAA