SecReT6
Protein ID: 157370025
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1783
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1958949..1959446 [+]
Producthypothetical protein
NoteTssB
UniProt IDA8GCP6
KEGG IDspe:Spro_1783
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-55, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|157370025|ref|YP_001478014.1| hypothetical protein Spro_1783 [Serratia proteamaculans 568]
MSNSYQSEIPKARVNIKLDLHTGGAQKKTELPLKLMVVGDYSNGTEQRPVSEREKVNVNKNNFDSVLAEF
SPSVNISVENTLAGDGSEENVSLTFREMNDFTPEQVARQIPQLKAMLAMRNLLRDLKANLLDNQAFRKEL
EKILLDPALSAELRSELSALAPKQA
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_009832.1|:1958949-1959446 hypothetical protein Spro_1783 [Serratia proteamaculans 568]
ATGTCTAACTCCTATCAGTCCGAGATCCCCAAAGCTCGCGTCAACATAAAACTTGATCTGCACACCGGTG
GTGCCCAGAAGAAAACCGAATTGCCCCTCAAGCTGATGGTGGTGGGGGATTACAGTAACGGCACGGAACA
ACGCCCGGTGTCTGAGCGTGAAAAGGTCAACGTTAATAAAAACAATTTTGACAGCGTGTTGGCCGAATTT
TCTCCCTCCGTAAATATTTCCGTTGAAAATACCCTGGCCGGTGATGGCAGCGAAGAGAACGTCAGCCTGA
CTTTCCGTGAGATGAACGATTTCACGCCGGAGCAGGTAGCCCGCCAGATCCCCCAGCTTAAAGCCATGCT
TGCCATGCGCAATCTCCTCCGCGACCTCAAGGCCAACCTGTTGGATAACCAGGCTTTCCGCAAAGAGCTG
GAAAAAATCCTGCTCGACCCGGCGCTTAGCGCTGAACTGCGCAGTGAGCTGTCTGCTCTGGCACCGAAGC
AAGCATAA