SecReT6
Protein ID: 157370026
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1784
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1959481..1961028 [+]
Producthypothetical protein
NoteTssC
UniProt IDA8GCP7
KEGG IDspe:Spro_1784
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.30E-175, Aligned region: 89..511
Protein Sequence: 515 a.a.     [Download]
>gi|157370026|ref|YP_001478015.1| hypothetical protein Spro_1784 [Serratia proteamaculans 568]
MLMSVKNENTAGGESVVLERPEASGVYASLFEKINLSPVSELSALDIWQDNQAMSDATADERLTAGMQVF
LECLTKSGSKVEKLDRTLIDHHIAELDYQISRQLDRVMHHEAFQSVESLWRGVKSLVDKTDFRQNVKIEL
LDLSKDDLRQDFEDAPEIIQSGLYKHTYIDEYDTPGGEPIGALISAYEFDASAQDVALLRNISKVSAAAH
MPFIGSAGPKFFLKDNMEDVAAIKDIGNYFDRAEYIKWKSFRETDDSRYIGLVMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPDHDKYLWTNASFAFAANMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLY
AVPHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1548 bp     [Download]
>ref|NC_009832.1|:1959481-1961028 hypothetical protein Spro_1784 [Serratia proteamaculans 568]
ATGCTGATGTCTGTAAAAAATGAGAATACCGCTGGCGGTGAGAGCGTGGTGCTGGAGCGTCCGGAAGCGA
GCGGTGTGTATGCTTCCCTGTTTGAAAAAATTAACTTAAGTCCGGTCTCCGAGTTGAGTGCGCTGGATAT
CTGGCAGGATAACCAGGCGATGTCCGATGCCACGGCTGACGAGCGTCTGACTGCCGGGATGCAGGTCTTT
CTGGAATGCCTGACTAAATCGGGTTCAAAAGTCGAGAAGCTGGACAGAACCCTGATTGACCACCACATCG
CGGAGCTGGATTATCAGATTAGCCGCCAGTTGGACAGAGTCATGCACCATGAGGCATTCCAGTCGGTAGA
ATCCCTGTGGCGCGGGGTGAAGTCACTGGTCGACAAAACCGACTTCCGTCAGAACGTCAAAATCGAGCTG
CTTGACCTGTCGAAGGACGATTTGCGTCAGGATTTTGAAGACGCGCCGGAAATCATTCAGAGCGGACTGT
ATAAACATACCTATATCGATGAGTACGACACCCCGGGTGGCGAACCTATTGGCGCACTGATTTCTGCCTA
CGAGTTTGATGCCTCTGCGCAGGACGTGGCGCTGCTGCGCAATATCTCCAAAGTCTCCGCTGCCGCTCAT
ATGCCGTTTATCGGATCGGCTGGCCCGAAATTCTTCCTCAAAGACAATATGGAAGACGTGGCGGCGATTA
AAGATATCGGCAACTACTTCGATCGTGCCGAATACATCAAATGGAAATCCTTCCGCGAGACGGACGATTC
CCGCTATATCGGTCTGGTGATGCCGCGTGTACTGGGCCGCCTGCCGTACGGTCCGGACACCGTGCCGGTG
CGCAGCTTCAACTACGTCGAAGAAGTGAAAGGCCCGGATCACGACAAATATCTGTGGACCAACGCCTCCT
TTGCGTTTGCCGCCAACATGGTGCGCAGCTTCATCAACAACGGCTGGTGTGTACAAATCCGTGGCCCGCA
GGCCGGTGGTGCCGTTCAGGACCTGCCTATCCATTTGTACGATCTGGGCACCGGCAATCAGGTGAAGATC
CCGAGTGAGGTGATGATCCCGGAAACTCGCGAGTTTGAATTCGCCAACCTGGGCTTTATCCCGCTGTCGT
ACTACAAGAATCGTGATTATTCCTGTTTCTTCTCCGCCAACTCCACCCAGAAACCGGCGCTGTATGACAC
CGCCGATGCGACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTACATCTTCCTGCTGTCACGCATTGCG
CATTACCTGAAGCTTATTCAGCGTGAAAACATCGGTACCACCAAGGATCGTCGTCTGCTGGAGCTGGAAC
TCAATACCTGGGTGCGCAGCCTGGTAACAGAAATGACCGATCCGGGCGACGACCTGCAGGCGTCTCACCC
GCTGCGTGATGCGAAAGTGACGGTGGAAGATATCGAAGATAACCCGGGCTTCTTCCGCGTGAAGTTGTAT
GCCGTACCGCATTTCCAGGTGGAAGGCATGGACGTGAATCTGTCGCTGGTTTCCCAGATGCCGAAAGCAA
AAGCCTAA