SecReT6
Protein ID: 157370027
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1785
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1961045..1962385 [+]
Producthypothetical protein
NoteTssK
UniProt IDA8GCP8
KEGG IDspe:Spro_1785
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-135, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|157370027|ref|YP_001478016.1| hypothetical protein Spro_1785 [Serratia proteamaculans 568]
MKTEQPLWGRGIMISPQHFQQQAAYATWSAECIARMGLNHPWGMIESAFEPEALKLGRLQACKLHVRFPD
GTLIDTDNADALPPVLSLDSESHDVVVLLALPLLRANGGNCLKPDEVAERPVRYRQRWRDIRNTFGDDSR
QIAVMQPELTLRFAHQNNSDYLTCPVARLQQDSQGVWRLDESFLPPLLTVRSSRWLVTQLEQLMTQLRAR
LIRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRNLQSPAERLHTELSRLAGSLLTFSLE
HQVSAIPAYQHEQLNAVFPPLFDLLSDLLEASLPSRVVSIELEHDKRLHFWQARLHDPRLREGADYYLSV
RSSMPVAQLQEQFPRQCKVGSPDHVRGIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATDML
DSGNCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>ref|NC_009832.1|:1961045-1962385 hypothetical protein Spro_1785 [Serratia proteamaculans 568]
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCATCATGATCTCTCCCCAGCATTTCCAGCAACAGGCCG
CGTATGCGACCTGGTCTGCGGAATGCATTGCCCGAATGGGACTCAATCATCCCTGGGGGATGATTGAGTC
TGCCTTTGAACCGGAGGCACTGAAGCTCGGTCGTCTGCAGGCCTGTAAGCTGCATGTCCGTTTCCCGGAC
GGGACGCTTATCGATACGGATAATGCCGATGCGTTGCCCCCGGTTCTGTCACTGGATAGCGAATCGCATG
ATGTGGTGGTGCTACTGGCGCTGCCCCTGCTGCGGGCGAATGGCGGCAACTGCCTGAAACCTGACGAGGT
GGCAGAGCGACCGGTGCGTTATCGCCAGCGCTGGCGGGATATCCGCAATACTTTCGGGGATGACAGCCGC
CAGATTGCGGTAATGCAGCCGGAACTGACGCTGCGCTTTGCCCATCAGAACAACAGTGATTATCTGACCT
GCCCGGTAGCCCGTCTGCAGCAGGATTCGCAGGGTGTCTGGCGGCTCGATGAGAGTTTTCTTCCGCCGCT
GCTGACTGTGCGGAGCAGCCGCTGGCTGGTGACCCAGCTCGAACAGCTGATGACCCAACTGCGAGCCCGC
CTGATCCGCCTGATGGCCATGCGCCGCGAAAGCAATGAACGGATGGCGGATTTTGCGGTGGCTGACGTAT
CCCTGTTCTGGCTGCTGAATGCCCTCAACAGTGCTGAGCCGGTGCTGGGCCAGTTCCAGCGCAATCTGCA
GAGCCCGGCAGAACGCCTTCATACCGAACTGTCCCGTCTGGCCGGCAGTTTGCTGACCTTCTCCCTGGAA
CATCAGGTGAGTGCGATACCGGCCTATCAGCACGAGCAACTGAATGCCGTTTTCCCACCGCTGTTTGATC
TACTGAGCGATTTGCTGGAGGCGAGCCTGCCGTCACGGGTGGTGTCAATTGAGCTTGAGCACGATAAGCG
GCTGCACTTCTGGCAGGCACGTCTGCACGATCCCCGTCTGCGTGAAGGTGCCGACTACTACCTGTCGGTA
CGCTCCTCGATGCCGGTGGCGCAGCTGCAGGAGCAGTTCCCGCGTCAGTGCAAAGTGGGAAGCCCGGATC
ATGTCAGGGGTATCGTGAACTCCTCACGCGTCGGGGTTCCGCTGACACCGCTGCGCCATGTGCCGGCGGC
CATTCCACTGCGTCTGGAGAACCAATATTTCAGCCTCGATGTCTCCCATCCCCTGGCAACTGACATGCTC
GACAGCGGCAACTGCATGTTTTATGTGCCGGGTATGCTTGGTGAGCCGGAGCTTGAACTCTTTGCGGTGC
TGAGAACATGA