SecReT6
Protein ID: 157370028
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1786
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1962382..1963071 [+]
Producthypothetical protein
NoteTssL
UniProt IDA8GCP9
KEGG IDspe:Spro_1786
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-40, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|157370028|ref|YP_001478017.1| hypothetical protein Spro_1786 [Serratia proteamaculans 568]
MSKRQRGTAASIDIDALLQDTWLQVVSLRHGPKFQDGEGRKLWEHCITDVERVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDLMRDVLREPAPDQAVVTCFQRVMM
LGFLGSFRSLNDPERQKLVSALSEHVPTISYPQAHPVLAESRAGRGMGGWLASWPVRIGLSVIVVAALWW
GLNHWLDQMLLTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>ref|NC_009832.1|:1962382-1963071 hypothetical protein Spro_1786 [Serratia proteamaculans 568]
ATGAGTAAACGTCAACGCGGGACAGCCGCGTCCATTGATATCGATGCCCTGCTGCAAGACACCTGGCTAC
AGGTCGTCAGCCTGCGCCACGGCCCGAAATTCCAGGACGGGGAAGGACGCAAACTGTGGGAGCACTGCAT
TACTGATGTCGAGCGTGTACAGCGTGAGTTGAAAGCGAGCGAACTCGATGAGGCCAGCTGTCAGCATATT
CTCACTGCACAGTGTGCGCTGCTCGACGAGGCGGTCAAAGGTCGCGGTGTGGAAGATGATGCCTGCGTAC
AGTGGTATGACATTCCGCTGCAGGGGCATTTCCTCGGCACCATGGATGCCGGTGACACCCTGTGCGATCT
GATGCGCGATGTGCTGCGTGAACCGGCTCCAGACCAGGCTGTCGTGACCTGCTTTCAGCGGGTCATGATG
CTGGGATTCCTCGGCAGTTTCCGCTCACTGAACGACCCGGAGCGCCAGAAACTCGTCAGCGCACTCAGTG
AACATGTCCCGACCATCAGCTATCCACAAGCCCATCCTGTCCTGGCGGAAAGCCGTGCCGGGCGGGGAAT
GGGGGGATGGCTGGCGTCATGGCCGGTGCGTATTGGCCTGAGCGTGATTGTGGTCGCCGCCCTGTGGTGG
GGGCTGAACCACTGGCTCGATCAGATGCTGTTGACCCTGTTGCCGGGAGCCGTGAAATGA