SecReT6
Protein ID: 157370030
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1788
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1964781..1965272 [+]
Producthypothetical protein
NoteTssD
UniProt IDA8GCQ1
KEGG IDspe:Spro_1788
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|157370030|ref|YP_001478019.1| hypothetical protein Spro_1788 [Serratia proteamaculans 568]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQQHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDVKDPAYEKHNHLEQLELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_009832.1|:1964781-1965272 hypothetical protein Spro_1788 [Serratia proteamaculans 568]
ATGGCAATTCCAGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAGGATCTGTAGATGTTA
AAGACCGCGAAGGCAGCATTGAAGTGGTGGCGCAGCAACACAACCTGTATATCCCGACCGATAACAACAC
CGGCAAGCTGACCGGCACCCGTATCCACACCCCGTTCCTGTTTACCAAGGAAATCGACTCTTCCAGCCCG
TATTTGTACAAGGCAGTGACCACCGGTCAGACCCTGAAATCAGCTGAATTCAAGTGGTACAAAATCAACG
ACGCCGGTCAGGAAGTGGAGTACTTCAACACTAAGTTGGAAAACGTGAAGGTGGTGAAGGTGAATCCGGT
CATGCATGACGTGAAAGACCCGGCTTACGAGAAACACAATCACCTCGAACAGCTTGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATTATTCATTCCGATTCCTGGAACGAACGCGCCACGGCGT
AA