SecReT6
Protein ID: 157370031
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1789
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1965445..1968099 [+]
ProductATPase
NoteTssH
UniProt IDA8GCQ2
KEGG IDspe:Spro_1789
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 236..256
AAA_2 [PF07724], Evalue: 2.00E-40, Aligned region: 610..775
AAA [PF00004], Evalue: 5.80E-20, Aligned region: 238..350
AAA [PF00004], Evalue: 5.80E-20, Aligned region: 615..733
AAA [PF00004], Evalue: 5.80E-20, Aligned region: 763..780
AAA_5 [PF07728], Evalue: 8.30E-15, Aligned region: 238..260
AAA_5 [PF07728], Evalue: 8.30E-15, Aligned region: 614..732
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 132..172
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 215..261
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 584..650
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 8.50E-15, Aligned region: 753..800
ClpB_D2-small [PF10431], Evalue: 9.50E-14, Aligned region: 781..856
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 458..489
AAA_22 [PF13401], Evalue: 4.00E-10, Aligned region: 611..655
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 238..260
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 291..326
AAA_25 [PF13481], Evalue: 9.70E-08, Aligned region: 610..643
AAA_19 [PF13245], Evalue: 9.10E-07, Aligned region: 235..262
AAA_19 [PF13245], Evalue: 9.10E-07, Aligned region: 546..557
AAA_19 [PF13245], Evalue: 9.10E-07, Aligned region: 610..636
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 216..319
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 607..631
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 684..696
IstB_IS21 [PF01695], Evalue: 6.00E-06, Aligned region: 232..298
IstB_IS21 [PF01695], Evalue: 6.00E-06, Aligned region: 614..632
NACHT [PF05729], Evalue: 7.20E-06, Aligned region: 238..334
NACHT [PF05729], Evalue: 7.20E-06, Aligned region: 614..635
AAA_14 [PF13173], Evalue: 8.00E-06, Aligned region: 238..336
AAA_14 [PF13173], Evalue: 8.00E-06, Aligned region: 484..532
AAA_14 [PF13173], Evalue: 8.00E-06, Aligned region: 612..696
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 238..340
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 613..649
AAA_17 [PF13207], Evalue: 1.10E-05, Aligned region: 797..816
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 232..259
Zeta_toxin [PF06414], Evalue: 2.00E-05, Aligned region: 601..654
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 222..253
Sigma54_activat [PF00158], Evalue: 4.30E-05, Aligned region: 613..731
AAA_29 [PF13555], Evalue: 0.0013, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.0013, Aligned region: 610..639
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 239..262
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0013, Aligned region: 712..733
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 25..58
Clp_N [PF02861], Evalue: 0.0015, Aligned region: 105..120
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 238..261
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 613..645
AAA_33 [PF13671], Evalue: 0.0026, Aligned region: 238..255
AAA_33 [PF13671], Evalue: 0.0026, Aligned region: 613..632
AAA_18 [PF13238], Evalue: 0.0029, Aligned region: 238..268
AAA_18 [PF13238], Evalue: 0.0029, Aligned region: 615..635
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 479..531
AAA_23 [PF13476], Evalue: 0.0038, Aligned region: 611..636
Mg_chelatase [PF01078], Evalue: 0.0055, Aligned region: 236..272
Mg_chelatase [PF01078], Evalue: 0.0055, Aligned region: 614..635
Mg_chelatase [PF01078], Evalue: 0.0055, Aligned region: 649..705
T2SE [PF00437], Evalue: 0.0058, Aligned region: 206..260
T2SE [PF00437], Evalue: 0.0058, Aligned region: 610..692
AAA_30 [PF13604], Evalue: 0.007, Aligned region: 235..300
AAA_30 [PF13604], Evalue: 0.007, Aligned region: 610..643
AAA_10 [PF12846], Evalue: 0.0097, Aligned region: 237..262
AAA_10 [PF12846], Evalue: 0.0097, Aligned region: 304..326
AAA_10 [PF12846], Evalue: 0.0097, Aligned region: 613..631
Protein Sequence: 884 a.a.     [Download]
>gi|157370031|ref|YP_001478020.1| ATPase [Serratia proteamaculans 568]
MENSAALLRRLNPYCARALEGAACLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
GWLDNLPRSVRSRPQLSGAIESLLKQAWMFASLEGSEHIRSVHLLAAMIEMPKMLRCDGVWPLLTLGQSQ
LERLRPLLDAQSDEREDVQQEEALAQTHGGDVEFVGRPVGAEIKEGELNPALQNALDKFTLDVTAKAKEG
NIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAESNVPDSLKTVSLRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPTPVLLFIDEAHAIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAEHHGVHITDGAVKAAVTLSRRYLTGRQ
LPDKAVDLLDTASARVRMSLDTVPEPLTRIRAQITSLEMEKQALLEDIAVGNQSHGERLTVIEQEENSLS
VELNELETQYRRELKLTEQLLESRQNISRQSETYRLQQELSDMQHSNSLLSVDVDTRTVANVIADWTGVP
LSSLMKDEQSELLSLESAIGKRVVGQDVALNAIAQRLRAAKTGLTSENGPQGVFLLVGPSGTGKTETALT
LADVLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDPIMQLLDEQPEATEGDLHELLRPILRDHFQPALL
ARFQTVIYRPLSEPAMRIIVEMKLGQVSKRLHRHYGLTTHIDESLFDALTAACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAAKQKPQSLRLSWSEEDGIGLEFDALQPDAV
 
Nucleotide Sequence: 2655 bp     [Download]
>ref|NC_009832.1|:1965445-1968099 ATPase [Serratia proteamaculans 568]
ATGGAAAATTCAGCCGCCTTGTTACGTCGCCTTAATCCTTACTGTGCCCGTGCGTTAGAAGGTGCAGCAT
GCCTGTGTCAGACCCGCGCCCACGCCGAAATTTTACCCGAACACTGGCTGCTGAAATTGCTGGAGCAGGG
CGAAGGTGACCTGACGGTGCTGGCGCGCCGTTATGAGTGGGATATGGACGCTCTGTGGCAGGATTTACTC
GGCTGGCTGGATAACCTGCCGCGTTCCGTGCGCAGCCGTCCTCAGTTGTCAGGCGCCATTGAATCCTTGT
TGAAACAGGCGTGGATGTTTGCCTCGCTTGAAGGCAGCGAACACATCCGTAGTGTGCATTTGTTGGCCGC
AATGATAGAAATGCCCAAAATGCTGCGCTGTGATGGCGTGTGGCCGCTGCTGACGCTGGGGCAGAGCCAG
CTTGAGCGTCTGCGCCCGTTACTGGACGCACAATCGGACGAGCGTGAGGACGTTCAGCAGGAAGAAGCGC
TGGCACAGACGCACGGTGGAGACGTTGAATTCGTCGGCCGTCCGGTCGGTGCAGAGATAAAAGAAGGTGA
ACTCAATCCTGCGCTCCAGAACGCACTGGATAAGTTCACGCTTGATGTCACCGCTAAAGCGAAAGAGGGC
AACATTGACCCGGTCTTTGGCCGCGATACCGAAATCCGCCAGATGGTGGATATTCTCTCAAGACGTCGCA
AGAACAACCCGATACTGGTCGGCGAACCGGGTGTGGGTAAAACGGCGCTGGTGGAAGGTTTGGCGCTGCG
TATCGCTGAAAGTAATGTCCCTGATAGCCTGAAAACCGTCAGCCTGCGCACTCTCGACCTGGGCCTGCTG
CAGGCGGGTGCCGGCGTGAAAGGCGAATTCGAACAGCGCCTGAAAAACGTCATCGATGCCGTACAGCAGT
CGCCGACACCCGTCCTGCTGTTTATCGATGAAGCACACGCCATTATTGGTGCGGGTAACCAGGCGGGCGG
CGCGGATGCGGCTAACCTGCTGAAACCTGCATTAGCAAGGGGGGAATTACGCACTATCGCCGCCACCACC
TGGAGCGAATACAAGCAGTATTTTGAACGCGATGCTGCACTGGAGCGTCGTTTCCAGATGGTCAAAGTCG
ATGAGCCGGACGACGACACCGCCTGCCTGATGCTCAGAGGCCTGAAAGCCCGTTATGCCGAACATCACGG
CGTGCATATCACTGATGGCGCAGTTAAAGCCGCAGTCACTCTCTCTCGCCGGTACCTGACCGGCCGTCAG
TTGCCGGACAAGGCGGTTGACTTGCTGGATACCGCGAGTGCCCGCGTGCGCATGAGCCTGGACACTGTAC
CGGAGCCGCTGACCCGCATCCGGGCGCAAATCACCTCGCTTGAAATGGAGAAACAGGCGCTGCTTGAAGA
TATTGCTGTGGGCAATCAGTCCCACGGTGAGCGCCTGACGGTGATTGAACAGGAGGAGAACAGCCTCAGC
GTGGAACTCAATGAACTGGAAACCCAGTATCGTCGGGAACTCAAACTCACCGAACAACTACTGGAAAGCC
GCCAGAACATCTCACGTCAGAGTGAAACCTACAGGCTGCAACAAGAGCTGAGCGATATGCAGCACAGTAA
CTCGCTGCTCTCAGTGGATGTGGACACTCGCACCGTGGCCAACGTGATTGCCGACTGGACCGGTGTCCCG
CTCTCCTCATTAATGAAGGACGAACAGTCCGAGTTGCTGAGTCTGGAAAGTGCAATCGGCAAGCGGGTGG
TAGGCCAGGATGTGGCCCTGAACGCTATCGCTCAGCGATTGCGTGCGGCAAAGACAGGCCTTACCTCGGA
GAATGGCCCGCAGGGCGTGTTCCTGCTGGTCGGCCCGAGCGGCACGGGTAAAACCGAAACCGCACTCACG
CTGGCCGATGTGCTGTACGGCGGTGAGAAATCCCTTATCACCATCAACCTGTCGGAATATCAGGAACCGC
ACACGGTCAGCCAGCTCAAGGGCTCGCCACCGGGCTACGTCGGTTACGGTCAGGGTGGCATTCTGACCGA
AGCGGTGCGTAAACGCCCGTACAGCGTGGTGTTGCTCGACGAGGTGGAAAAAGCGCACCGCGACGTAATG
AATCTGTTCTATCAGGTGTTTGACCGGGGCTTTATGCGCGACGGCGAAGGCCGTGAAATTGATTTCCGTA
ACACCGTGATCCTGATGACGTCCAACCTCGGCAGCGACCCCATCATGCAACTACTGGATGAACAGCCAGA
AGCCACCGAAGGCGATTTGCACGAACTGCTGCGCCCGATATTGCGTGACCACTTCCAGCCCGCGCTGCTG
GCCCGTTTCCAGACCGTGATTTACCGCCCGCTGAGTGAGCCTGCGATGCGCATCATTGTTGAAATGAAAC
TCGGACAGGTCAGCAAACGCCTGCACCGTCACTATGGCCTGACCACGCATATTGACGAAAGTCTTTTCGA
TGCTCTGACCGCCGCCTGCCTGTTGCCGGATACCGGCGCACGTAACGTCGACAGCCTGCTCAATCAACAA
ATTCTACCGGTACTGAGTCAGCAACTGCTGACCCACATGGCTGCAAAACAGAAACCACAGTCGTTACGCC
TTAGCTGGAGTGAGGAAGATGGCATAGGGCTGGAGTTTGACGCTCTGCAACCGGACGCTGTGTGA