SecReT6
Protein ID: 157370032
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1790
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1968619..1970997 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA8GCQ3
KEGG IDspe:Spro_1790
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.60E-62, Aligned region: 33..350
DUF2345 [PF10106], Evalue: 3.10E-41, Aligned region: 614..760
T6SS_Vgr [PF13296], Evalue: 1.60E-35, Aligned region: 489..589
T6SS_Vgr [PF13296], Evalue: 1.60E-35, Aligned region: 629..657
Phage_base_V [PF04717], Evalue: 1.90E-16, Aligned region: 389..482
Protein Sequence: 792 a.a.     [Download]
>gi|157370032|ref|YP_001478021.1| Rhs element Vgr protein [Serratia proteamaculans 568]
MSANPISFFSHNHHLLAIKGCESELDVLAFEGNEALSKPFSYRIEFTSNDHTISKEMMLMKAGSLTLQAP
ADQGYGIKIQQSVRVLQGVVSGFERLNTSKDETHYALTLQPRLALLDRSHQNAVYQDMSVPQIVEKILRE
RHNLRGQDFLFSLTREYPRREQVMQYGEDDLHFITRLLGEVGIWFRFTTDTRLNIDVVEFYDSRQGYEKG
LILPSVPPSGQHSQGMDSVWGMESYHNVVQKQVSTRDYNYRQANNDMNTQVDATRGDSTTYGEAYHYADN
YLTPGSTYDRNPAPESGAFYARIRHERYLNGQTQLSAITSCPTLAPGLVLKVTGGYEVTEAFSQGVLITG
MKSAARRDKDFEVHFSGIPDSTDFGFRPEPGARPVMAGTLPARVTSTTENDTYGHIDKDGRYRVNMLFDR
DNWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHDDHVTIRNYKRN
VLRTPSNNKIRLDDSRGQEHIKISTEYGGKSQLNLGHLVDSEKQKRGEGFELRTDSWGAIRAQKGIFISA
DGQAKAQGQVLEMEPAISLLKGALNQVTGWGTITQTHHNIAPDAEPLREFVSGASELKEPALLLSAPKGI
AAVTPETTLIHSGKGLYLQSLGEVNISTAQRYSVNASKAISILSQQEGIRLVSAKGPLAVESHADTLSLT
SMKDVTVQSTQGHLQLTAKNGITLACGGAYIQLTPQGEINVHGPGLLSLKGQHKLQGPTSEDYPLPELPS
SVCKECLKKAQQAAQGFVPREV
 
Nucleotide Sequence: 2379 bp     [Download]
>ref|NC_009832.1|:1968619-1970997 Rhs element Vgr protein [Serratia proteamaculans 568]
GTGAGTGCAAACCCGATTTCTTTTTTCAGCCATAACCACCACCTGCTGGCGATAAAAGGATGTGAGTCAG
AACTTGATGTGCTGGCGTTTGAAGGCAACGAGGCCCTGAGCAAGCCGTTCAGTTACCGCATTGAGTTCAC
CAGTAACGACCACACCATCAGCAAGGAAATGATGCTGATGAAAGCGGGCTCTTTGACGCTACAGGCCCCG
GCAGACCAGGGGTACGGCATTAAAATTCAGCAATCGGTACGGGTTCTCCAGGGGGTGGTGAGCGGTTTTG
AACGTCTCAACACCTCAAAAGATGAAACCCATTACGCCCTGACGCTACAGCCGCGTCTGGCATTGCTCGA
CCGCTCGCATCAGAACGCGGTTTATCAGGATATGTCGGTGCCGCAGATTGTGGAAAAAATCCTGCGCGAG
CGCCACAACCTGCGCGGCCAGGATTTTCTGTTCTCGCTGACCAGAGAATACCCGCGGCGTGAACAGGTGA
TGCAGTACGGCGAGGATGACCTGCACTTTATCACCCGCCTGCTGGGTGAGGTGGGTATCTGGTTCCGCTT
TACCACCGACACGCGCCTGAACATCGACGTGGTGGAGTTCTACGACAGCCGGCAGGGCTACGAGAAAGGC
CTGATTCTGCCGTCTGTACCGCCGTCGGGCCAGCACTCGCAAGGCATGGATTCGGTATGGGGGATGGAGA
GCTATCACAACGTGGTGCAAAAGCAGGTCAGCACCCGCGATTACAACTACCGCCAGGCCAACAACGACAT
GAACACCCAGGTGGATGCGACCCGCGGTGACAGCACCACCTACGGCGAGGCTTATCACTATGCCGACAAC
TACCTGACACCGGGCAGTACCTATGACCGCAATCCGGCCCCGGAGTCCGGGGCGTTTTATGCCCGTATAC
GTCACGAACGCTACCTGAACGGCCAGACCCAACTGAGCGCCATCACCAGTTGCCCGACACTGGCGCCCGG
ACTGGTACTGAAAGTCACCGGCGGTTATGAAGTGACGGAGGCGTTCAGCCAGGGTGTGCTCATCACCGGG
ATGAAAAGCGCGGCCCGCCGAGATAAAGATTTTGAGGTGCATTTCAGCGGTATCCCGGACAGCACCGATT
TTGGCTTCCGCCCTGAACCCGGTGCGCGTCCGGTAATGGCCGGCACTTTACCAGCCCGCGTCACCAGTAC
CACCGAAAATGACACCTACGGGCATATCGATAAAGATGGCCGCTATCGCGTCAACATGCTGTTTGACCGT
GATAACTGGGAGACCGGGTTCGAGAGCCTGTGGGTGCGTCAGTCCCGCCCCTATGCCGGCGACACTTATG
GTCTGCACCTGCCGCTGCTGGCGGGAACCGAGGTGGCGATTGGTTTTGAAGACGGCAACCCGGACCGGCC
CTATATTGCCGGGGTGCTGCACGACTCCGCGCACGACGATCACGTCACCATCCGCAACTACAAGCGCAAC
GTACTGCGCACACCGAGCAACAACAAAATCCGCCTCGATGACAGCCGGGGCCAGGAACATATCAAGATCT
CGACGGAGTATGGCGGCAAGAGCCAGCTGAATCTCGGGCATCTCGTCGATAGCGAGAAGCAAAAACGGGG
CGAGGGTTTTGAACTCAGAACCGACAGCTGGGGCGCGATTCGGGCGCAGAAGGGCATTTTCATCAGTGCC
GATGGTCAGGCAAAGGCGCAGGGCCAGGTGCTGGAGATGGAGCCAGCGATCAGCCTGCTAAAAGGGGCGC
TAAATCAGGTAACCGGATGGGGAACTATTACGCAGACGCACCATAATATTGCTCCTGATGCAGAGCCACT
AAGAGAATTTGTTTCCGGTGCCAGCGAGCTTAAAGAACCTGCGTTGCTGCTGTCTGCTCCGAAGGGGATT
GCCGCCGTCACGCCGGAAACGACTCTGATACACAGTGGGAAAGGGCTGTACCTGCAGAGCCTGGGCGAAG
TCAATATCAGCACAGCACAGCGCTATTCGGTAAACGCCAGTAAGGCAATCTCGATTCTCTCGCAACAGGA
AGGAATACGCCTGGTCTCTGCCAAAGGCCCGCTGGCGGTGGAATCCCACGCGGATACGCTGTCACTCACA
TCGATGAAGGATGTCACGGTTCAGTCCACCCAGGGGCACCTGCAACTGACGGCAAAGAATGGGATCACGC
TTGCCTGTGGCGGTGCTTACATCCAACTGACCCCACAGGGCGAAATCAACGTGCATGGTCCAGGTCTGCT
AAGTCTCAAAGGGCAGCACAAATTACAGGGCCCGACGAGTGAGGATTATCCGCTGCCTGAATTGCCTTCG
TCGGTGTGCAAAGAGTGTCTGAAAAAGGCGCAGCAGGCTGCACAAGGCTTTGTGCCAAGGGAGGTATAA