SecReT6
Protein ID: 157370042
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1800
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1982588..1984342 [+]
Producthypothetical protein
NoteTssF
UniProt IDA8GCR3
KEGG IDspe:Spro_1800
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.20E-181, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|157370042|ref|YP_001478031.1| hypothetical protein Spro_1800 [Serratia proteamaculans 568]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKSGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEQMRIAKGFEVLSRPIGEKGTRCRYTTTQELNLQPLS
LEQARLATDADGRSVVTLRFNCSNLADWSRIDFSSISLYFNADAPLACAMHAAFTLNVARMWLRMPGDID
RRPLDGHFTAQGFGDDDALWPKGSSSFSGYQLLLEYFTFREKFMFTGLRGLESVAFPAALPWFEIDVVLA
ERWEHDFSFTEKHLRLNCVPVINLFPLESDPLALNSLQTEYMLRPMRVQDGHTEIYAVDSVTSSSQHTYV
PFSSFRHKGGMMRHQAPEYYYHTRVRRGPSGLHNTWLILGGEAFDHHTVPEDESLSLTLTGTNGQLPRRT
LQSTVLDTVMKTTSTSIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAIIDVKHSETERFEQGYLVRGVQIEVTLDSHGFAGRGDICLFGEMLSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>ref|NC_009832.1|:1982588-1984342 hypothetical protein Spro_1800 [Serratia proteamaculans 568]
ATGGACGACTTAACCCTGCGTTATTACGACGCCGAAATGCGCTACCTGCTGGAAGCTGGTGAAGAGTTTG
CCCGCGCTCATCCTGAGCAGGCGGCGATGCTGAACCTCGATAAATCTGGCGCCCGCGACCCCTATGTGGA
GCGTCTGTTTGAAGGCTTTGCCTTCCTGATGGGCCGGCTTCGCGAAAAGCTTGACGACGATTTGCCGGAG
CTGACCGAAGGGCTGGTCAGCCTGCTGTGGCCGCATTACCTGCGCACCATTCCTTCCATGTCCGTGGTCG
AATTCACGCCGGACTGGCGCGAAATGAAAGAGCAGATGCGGATCGCCAAAGGTTTCGAGGTGTTGTCGCG
TCCGATCGGCGAAAAAGGGACGCGCTGCCGTTACACCACCACCCAAGAGCTCAACCTTCAACCGCTGTCG
CTGGAGCAGGCCAGACTGGCCACCGATGCGGATGGTCGCTCGGTTGTCACGCTGCGTTTTAATTGCAGTA
ATTTGGCAGACTGGAGCCGTATCGATTTCAGCAGTATTTCACTTTACTTCAACGCCGATGCGCCGCTGGC
CTGCGCCATGCACGCCGCCTTTACCCTGAATGTGGCCCGGATGTGGCTGCGGATGCCGGGCGATATAGAC
AGAAGACCGCTGGATGGGCATTTCACCGCGCAGGGCTTTGGCGATGACGATGCCTTATGGCCAAAAGGCA
GTAGCAGTTTCAGTGGCTACCAACTGCTGCTGGAGTACTTCACCTTCCGCGAGAAATTCATGTTCACCGG
CCTGCGAGGGCTGGAGAGCGTCGCCTTTCCGGCTGCGCTCCCCTGGTTTGAAATCGATGTGGTGCTGGCT
GAACGTTGGGAACATGACTTCAGCTTTACCGAAAAGCATCTGCGCCTTAACTGCGTGCCGGTTATCAACC
TCTTCCCGCTGGAGTCTGATCCGCTGGCGCTGAACTCCCTGCAAACAGAATACATGCTGCGCCCGATGCG
CGTGCAGGACGGCCACACCGAGATTTACGCCGTGGATTCGGTGACGTCATCCAGTCAGCATACCTATGTG
CCGTTCTCCAGTTTTCGCCACAAAGGCGGAATGATGCGCCACCAAGCGCCGGAATATTACTACCACACCC
GCGTACGCCGTGGCCCTTCGGGGCTGCACAACACCTGGCTGATCCTCGGTGGCGAAGCCTTTGACCATCA
CACTGTGCCGGAAGATGAAAGTCTGTCGCTGACGCTCACCGGCACCAATGGCCAACTGCCACGACGTACG
CTGCAAAGTACCGTGCTTGATACGGTGATGAAAACCACCTCGACCAGCATCGCCGTGCGCAACCTGTGTG
CGCCAACGCTTCCCTGTTACCCACCGGCGCAGGACCGGTTTCACTGGCGCGTGCTGAGCCACCTCGGCAG
CGGGTTCCTCTCGATGATGGATAACGCCGACGTGCTGCGCGGTACTCTGGCGCTGTATGAGTGGACGGAC
AGCGAGATGAACCGCCGTCGCCTGGAGGCCATCATCGACGTGAAGCACAGCGAAACCGAGCGCTTCGAGC
AGGGCTATCTGGTGCGCGGCGTGCAGATTGAAGTGACCCTCGACAGCCACGGCTTTGCCGGTCGGGGCGA
CATCTGCCTGTTTGGCGAAATGCTGAGCCGTTTCTTTGCCCTCTATACCGATATTTACCTGTTTAACCGC
CTGATTATCATTCTGCAACCGACCGGAGAGCGTCTGGAATGGGAAGAGAAGCACAACCGCCGCATTCCCG
GCTGA