SecReT6
Protein ID: 157370043
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1801
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1984306..1985391 [+]
Producthypothetical protein
NoteTssG
UniProt IDA8GCR4
KEGG IDspe:Spro_1801
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-79, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|157370043|ref|YP_001478032.1| hypothetical protein Spro_1801 [Serratia proteamaculans 568]
MGREAQPPHSRLTPRLEADLHRINFYRLCQLLEKRNPGRPLMGSTSHPADDPVRFAPHPGMGFPVSELKA
VEYDENDDSKPPLIRTTFMGMYGVDSPLPTAYLDDITQRREGHEALQGFLDIFSHRILTQFYRIWRKYSY
PAAFEPGGTDSISQSLLGLVGLGIPGTANHIATPVSRFLALLGVLRQPGKTQEGMQALVSLLAPDTAVQV
SPYCLRPVEISQPLGFYGDEDFLLDGNTPLGDEAMDANSQLLIVLSTDNEQEAQGWKPDGLLYQDLLVML
RVYLGWRFKAKIQLRVSTRLLTVPPLGDGPFWLGMNAVLGAEGDLLPDDIPQAFTTDLGYYHGMKPATPQ
QGNRRVTYQFD
 
Nucleotide Sequence: 1086 bp     [Download]
>ref|NC_009832.1|:1984306-1985391 hypothetical protein Spro_1801 [Serratia proteamaculans 568]
ATGGGAAGAGAAGCACAACCGCCGCATTCCCGGCTGACCCCGCGGCTGGAAGCCGACCTTCACCGCATTA
ACTTTTACCGTTTATGCCAGCTGCTGGAGAAGCGTAATCCGGGCAGACCGCTGATGGGCTCAACCAGCCA
TCCCGCTGATGACCCAGTGCGATTTGCGCCGCATCCGGGGATGGGATTTCCTGTCAGTGAACTGAAAGCC
GTTGAATATGACGAGAACGACGACAGTAAGCCACCGCTCATCCGCACCACCTTTATGGGGATGTACGGTG
TCGACTCACCGTTGCCGACGGCCTATCTCGATGACATCACCCAGCGCCGGGAAGGGCATGAAGCGCTGCA
GGGCTTTCTCGATATCTTCAGTCATCGCATCCTGACGCAGTTTTATCGCATCTGGCGAAAGTATTCTTAC
CCGGCCGCGTTCGAACCCGGCGGAACCGACAGCATTTCGCAGTCGCTGTTGGGCCTAGTGGGGTTGGGTA
TTCCGGGGACGGCAAATCACATCGCCACGCCGGTGTCACGCTTTCTGGCGCTGCTGGGCGTGTTGCGTCA
GCCCGGCAAAACCCAGGAAGGGATGCAGGCGCTGGTGAGCCTGCTGGCACCGGACACGGCGGTGCAGGTC
AGTCCGTATTGCCTGCGGCCGGTGGAAATCAGCCAGCCGTTGGGATTTTACGGTGATGAGGACTTTCTGC
TGGATGGCAACACGCCGCTCGGTGATGAAGCGATGGATGCCAACAGCCAGTTGCTGATTGTGCTTTCAAC
GGATAACGAGCAGGAAGCGCAGGGCTGGAAGCCGGATGGTCTGCTGTATCAGGATTTGCTGGTGATGCTG
CGGGTCTATCTGGGCTGGCGGTTTAAGGCAAAAATCCAGCTCAGAGTCAGTACCCGCCTGCTGACCGTCC
CGCCGCTGGGTGATGGCCCTTTCTGGCTGGGGATGAATGCTGTGTTGGGCGCGGAAGGGGACCTGCTCCC
GGACGACATCCCGCAGGCCTTTACGACGGATCTGGGCTATTACCACGGCATGAAGCCCGCCACACCACAA
CAAGGAAACCGACGTGTTACCTACCAATTTGACTAA