SecReT6
Protein ID: 157370044
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1802
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1985369..1985914 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA8GCR5
KEGG IDspe:Spro_1802
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.00E-37, Aligned region: 19..172
Protein Sequence: 181 a.a.     [Download]
>gi|157370044|ref|YP_001478033.1| hypothetical protein Spro_1802 [Serratia proteamaculans 568]
MLPTNLTKTVRWQLALLAFSLTGCGVTQSVTDGTKSAFTAVFYKKIKILHLDFTAREALNTDARESNSLS
EPVVVRVYQLKDRKTFDKTVYQQLLKDGDTLLKTDLLATRDVVVKPGGDASLNMPMEADAKFVAVAGLFR
HPDLVNNTWRRVIEREELDPDKPRILEAGNNYLTLLPAKDD
 
Nucleotide Sequence: 546 bp     [Download]
>ref|NC_009832.1|:1985369-1985914 hypothetical protein Spro_1802 [Serratia proteamaculans 568]
GTGTTACCTACCAATTTGACTAAAACCGTACGCTGGCAGCTCGCGCTGCTGGCGTTCAGCCTGACGGGCT
GTGGGGTGACGCAGAGCGTCACGGACGGCACAAAGTCGGCCTTCACCGCCGTTTTTTACAAGAAGATTAA
AATCCTGCATCTGGATTTTACCGCGCGCGAGGCGCTCAATACCGATGCCCGAGAGAGCAATTCGCTGTCG
GAGCCGGTTGTGGTGCGCGTTTACCAGTTGAAAGACCGCAAAACCTTCGACAAGACGGTGTATCAGCAAC
TGCTGAAAGACGGCGACACCCTCCTGAAAACCGATTTGCTGGCCACCCGCGATGTGGTGGTAAAACCGGG
CGGCGATGCCAGCCTCAATATGCCCATGGAAGCCGATGCGAAGTTTGTGGCGGTCGCGGGGCTGTTCCGT
CATCCGGATTTGGTTAATAACACCTGGAGGCGGGTGATTGAGCGTGAAGAGCTGGACCCGGATAAGCCGC
GCATCCTGGAGGCCGGGAATAACTATCTGACATTGCTACCCGCTAAGGACGATTAA