SecReT6
Protein ID: 157370045
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1803
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1985914..1986363 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA8GCR6
KEGG IDspe:Spro_1803
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.40E-16, Aligned region: 32..117
Protein Sequence: 149 a.a.     [Download]
>gi|157370045|ref|YP_001478034.1| GPW/gp25 family protein [Serratia proteamaculans 568]
MPQGHNPPSLYEMLVGNFAGGLGLHQVSEENQFILSVLDNMQRILNCRAGTLAHLPDYGLPDMAKILQGM
PGTSHQLMGTLTSVLLKYEPRLKNVAVVILEQAQPGELRYAIDAELKGIGLVRYGTEFMPEGRVLLRHLK
QQQYLDNSP
 
Nucleotide Sequence: 450 bp     [Download]
>ref|NC_009832.1|:1985914-1986363 GPW/gp25 family protein [Serratia proteamaculans 568]
ATGCCTCAGGGACATAATCCCCCGTCGTTGTATGAAATGCTGGTCGGCAATTTCGCCGGCGGCCTCGGCC
TCCATCAGGTTAGCGAAGAAAATCAGTTCATTCTGTCGGTGCTGGACAATATGCAGCGCATCCTCAACTG
TCGCGCCGGGACGCTGGCCCATTTACCCGATTATGGTCTACCTGATATGGCGAAAATCCTGCAGGGGATG
CCGGGTACCTCACATCAACTGATGGGCACGCTGACATCCGTTTTGCTGAAATATGAACCCCGCCTGAAAA
ACGTTGCCGTGGTGATACTGGAACAGGCTCAGCCCGGTGAACTGCGTTATGCCATCGATGCAGAGCTGAA
GGGTATAGGTCTGGTGCGTTATGGCACCGAATTTATGCCTGAGGGGCGGGTGCTGTTACGCCACTTGAAA
CAACAGCAGTATCTTGATAATTCGCCGTAA