SecReT6
Protein ID: 157370046
SecReT6 ID233
T6SS typei2
Gene symbol-
Locus tagSpro_1804
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]1986614..1988005 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA8GCR7
KEGG IDspe:Spro_1804
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 4.40E-52, Aligned region: 29..49
DUF3702 [PF12486], Evalue: 4.40E-52, Aligned region: 112..149
DUF3702 [PF12486], Evalue: 4.40E-52, Aligned region: 314..458
ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 366..385
Protein Sequence: 463 a.a.     [Download]
>gi|157370046|ref|YP_001478035.1| ImpA domain-containing protein [Serratia proteamaculans 568]
MNDIPSRKIKTGNDPRTLPDYAALRDELSKLSHPARPDVNWRYAEKLCLSLFEQNGVELQTAAWYTLART
QLAGLFGLNEGLSILEALISHQWGALWPQPVHARMEILSGLSQRIQQLMRTLPLNYSDLSQLYLAEQQLA
SLGVILQRLELKHLSQFDTLRTLMHNSAVRLENSDGALGSDVVIQPGIVLPAATMNDSGISSAAHSAIPV
AEKDVPASPVKWVYVTQPEHQAHVEVLAAVPVPAKKWYFFAAGMCSMLVISAATVWGWHVLHRPDPLQTQ
FAASLAPLPATLTPEQLDMLRQQSPLPQTGIAQTQQQLARLDQLPPDWNIAYSRQLVEQAQALWPEQAKP
LVQQWQRQLNAAGIPTENLNGWHQGMTKLQQLSDRLSGLDEQKGKYMTVSELKSVVFSTMQSFNQSIPAE
EQLRALSENPAGEPLPVAGRAQLEVHLKQLTARYAEIKLKASK
 
Nucleotide Sequence: 1392 bp     [Download]
>ref|NC_009832.1|:1986614-1988005 ImpA domain-containing protein [Serratia proteamaculans 568]
ATGAATGACATTCCCTCCCGTAAAATTAAAACCGGTAACGATCCTCGAACATTGCCGGATTATGCTGCCC
TGCGCGATGAGCTGAGCAAACTGTCACATCCGGCGCGTCCGGATGTGAACTGGCGTTATGCTGAAAAACT
CTGTCTTTCGCTGTTTGAACAAAATGGCGTGGAGCTACAGACGGCAGCCTGGTACACATTGGCCCGTACG
CAATTGGCCGGGCTGTTTGGTCTGAATGAAGGATTGTCCATCCTGGAAGCCCTGATAAGCCACCAGTGGG
GGGCGCTCTGGCCGCAGCCGGTACATGCGCGGATGGAAATCCTCAGCGGTCTGAGCCAGCGTATACAACA
ACTGATGCGTACTCTCCCCCTGAATTACAGTGACCTTAGCCAGCTTTATCTTGCAGAACAGCAGCTTGCC
AGCCTTGGGGTGATATTACAGCGCCTGGAGCTCAAGCACCTGAGCCAGTTCGATACCTTGCGTACCCTGA
TGCATAACAGTGCCGTTCGGCTGGAAAACAGTGACGGCGCATTGGGTTCTGATGTTGTTATTCAGCCCGG
AATTGTGCTGCCTGCGGCGACAATGAATGATTCAGGAATATCATCTGCAGCCCACTCTGCTATTCCGGTT
GCAGAGAAAGACGTACCGGCCAGTCCAGTGAAATGGGTGTACGTAACGCAACCAGAACACCAGGCGCATG
TGGAAGTACTGGCAGCGGTGCCGGTTCCGGCAAAAAAGTGGTATTTCTTTGCCGCCGGGATGTGTTCCAT
GCTGGTGATAAGTGCGGCAACGGTGTGGGGCTGGCATGTCTTGCACCGACCTGACCCGTTACAGACTCAG
TTTGCTGCATCCCTGGCGCCGTTACCCGCAACACTCACGCCCGAGCAGTTGGATATGTTGCGTCAGCAAT
CTCCGTTACCACAAACTGGAATCGCGCAAACACAGCAGCAGCTTGCCCGGCTGGATCAATTGCCTCCTGA
CTGGAATATTGCCTACAGTCGGCAGCTCGTAGAACAGGCTCAGGCGCTTTGGCCGGAGCAGGCTAAACCT
CTGGTACAACAGTGGCAGCGGCAGTTAAACGCTGCCGGCATACCGACAGAAAACCTGAATGGCTGGCATC
AAGGGATGACGAAGCTACAGCAACTGAGTGACCGACTGAGCGGGCTGGATGAGCAGAAGGGTAAATACAT
GACGGTCAGTGAGCTGAAATCAGTGGTATTTTCAACCATGCAGTCATTTAACCAATCCATACCGGCAGAA
GAGCAACTGCGAGCATTGTCAGAAAACCCTGCGGGAGAACCTTTACCTGTTGCTGGCAGGGCCCAACTGG
AAGTGCATCTGAAGCAACTGACCGCCCGTTATGCTGAAATAAAACTGAAAGCATCAAAATAA