SecReT6
Protein ID: 157371237
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_2997
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3294549..3295079 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDA8GG58
KEGG IDspe:Spro_2997
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-33, Aligned region: 20..150
Protein Sequence: 176 a.a.     [Download]
>gi|157371237|ref|YP_001479226.1| putative lipoprotein [Serratia proteamaculans 568]
MITTPTTSRWCGIVFLLLGALVLNGCMSSAKSVPSRYSLVFDADSQVNAAAGQRPAPIKIRVLLLRSDAE
FMDADFFSLQSDAKSVLGASLLDSDQFFLTPGQRGKKLGGQSTLETRYIGIIAEYQNLDGKAWRISLPLP
EPTETNFYKVWQFSPDELEAHIVAGINGLHSVKDPD
 
Nucleotide Sequence: 531 bp     [Download]
>ref|NC_009832.1|:3294549-3295079 putative lipoprotein [Serratia proteamaculans 568]
ATGATAACAACACCCACCACCTCCCGCTGGTGCGGGATAGTGTTCCTGCTGTTGGGCGCATTGGTGCTCA
ACGGCTGCATGTCTTCTGCCAAGAGCGTGCCCTCGCGTTATAGCCTGGTCTTCGATGCCGACAGCCAGGT
GAACGCCGCGGCAGGCCAACGACCGGCACCGATAAAGATTCGGGTACTGCTGCTACGTTCCGATGCGGAA
TTTATGGACGCTGACTTCTTCAGCCTGCAGAGCGATGCCAAAAGCGTGCTCGGCGCCAGCCTGCTGGACA
GCGACCAATTCTTCCTGACCCCGGGCCAAAGGGGCAAGAAACTCGGCGGCCAAAGCACGCTCGAAACTCG
TTATATCGGCATCATCGCCGAATATCAGAACCTCGATGGCAAAGCCTGGCGCATTTCACTGCCGCTACCG
GAACCGACCGAGACCAATTTCTACAAGGTGTGGCAATTCTCACCGGATGAGCTGGAAGCCCACATTGTGG
CAGGCATTAATGGCCTGCACTCCGTGAAAGATCCCGACTGA