SecReT6
Protein ID: 157371238
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_2998
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3295120..3296466 [+]
Producthypothetical protein
NoteTssK
UniProt IDA8GG59
KEGG IDspe:Spro_2998
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.00E-152, Aligned region: 19..443
Protein Sequence: 448 a.a.     [Download]
>gi|157371238|ref|YP_001479227.1| hypothetical protein Spro_2998 [Serratia proteamaculans 568]
MKDAHKVVWTEGMFLRPHHFQQAENYLENYMRNWGQAHQGYFWGFLQLDLDQTLLRQGKIALNAASGIMP
DGTPFRFSGAQQAPAPLAIAENKTGENVVLALPTYRAGREDVIFQEAPDALARYLAYENEVDDLNAVSVG
SAALQFGQLRLRLMLESELNAEWTALGVTRVLEKRGDASLRLDQVQIPPMLNCQGSPVLKTFINDLQGLL
QQRSQQMSQRLLQPGRGGSSEMVDFMLLQLINRHLGQVSHAYHLDHLHPERLFADWLQFATELASFSAQR
TPEARLPVYDHDNLALCFGKLMLLLRQGLSVVLEDNAIQLTLVERSHGLNIATVQDTKMMRDFGFVLAVR
ADVAAEVLLTHFPAQMKIAPVTRIRDLVQLQLPGIGLRTMPAAPRQIPYHAGYTYFELEKGSDLWKQMEK
SSAFALHLAGDFPGLDMEFWAIRSHTDR
 
Nucleotide Sequence: 1347 bp     [Download]
>ref|NC_009832.1|:3295120-3296466 hypothetical protein Spro_2998 [Serratia proteamaculans 568]
ATGAAAGATGCTCATAAGGTCGTCTGGACTGAAGGGATGTTTTTGCGCCCTCATCATTTCCAGCAGGCGG
AAAACTATCTCGAAAACTACATGCGTAATTGGGGCCAGGCCCACCAAGGTTATTTTTGGGGCTTCCTCCA
GCTGGATTTGGATCAAACCTTGCTGCGTCAGGGCAAAATTGCGCTTAACGCCGCTAGTGGCATCATGCCG
GACGGCACGCCCTTTCGTTTTTCCGGTGCCCAACAGGCGCCTGCTCCGCTGGCCATTGCCGAAAACAAGA
CCGGCGAAAACGTGGTTCTGGCATTGCCAACCTACCGCGCGGGCCGTGAAGACGTGATTTTTCAGGAAGC
ACCGGACGCGCTGGCGCGTTATCTGGCCTATGAAAACGAAGTCGACGACCTGAACGCCGTTTCGGTCGGC
AGCGCGGCATTGCAGTTTGGTCAGCTGCGTCTACGTCTGATGCTGGAAAGCGAACTCAATGCCGAATGGA
CGGCCCTCGGCGTAACCCGGGTGCTGGAAAAACGCGGTGACGCCAGCCTGCGTCTCGATCAGGTGCAAAT
TCCGCCGATGCTGAACTGTCAGGGAAGCCCGGTGCTGAAAACCTTTATCAACGATCTGCAAGGCCTGCTG
CAACAGCGTAGCCAGCAGATGAGTCAGCGCCTGCTGCAGCCGGGGCGCGGCGGCAGTTCCGAGATGGTCG
ATTTCATGCTGTTGCAACTGATTAACCGCCATCTCGGCCAGGTGAGCCACGCTTACCATCTCGATCACCT
GCACCCGGAACGCCTGTTCGCCGACTGGCTGCAGTTCGCCACCGAGCTAGCCAGCTTCTCGGCGCAGCGC
ACACCGGAAGCCCGGCTGCCGGTGTACGACCATGACAACCTGGCGCTGTGTTTCGGCAAATTGATGCTGT
TGCTGCGCCAGGGGCTGTCGGTGGTACTGGAAGACAACGCCATCCAACTGACGCTGGTCGAACGCTCGCA
TGGCCTGAACATTGCCACCGTACAAGACACCAAAATGATGCGCGACTTCGGTTTCGTGCTGGCGGTACGT
GCCGATGTCGCCGCCGAAGTGCTGCTGACTCACTTCCCGGCGCAAATGAAGATTGCCCCGGTAACGCGTA
TTCGCGATCTGGTGCAGTTGCAACTGCCAGGCATCGGGCTGCGCACCATGCCGGCGGCACCACGCCAAAT
CCCCTATCACGCGGGTTATACCTATTTCGAATTGGAAAAAGGCAGTGACCTGTGGAAGCAGATGGAAAAA
TCCAGCGCCTTCGCTCTGCACCTGGCCGGCGACTTCCCGGGTCTGGATATGGAATTCTGGGCGATTCGCA
GCCATACGGACCGGTAA