SecReT6
Protein ID: 157371239
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_2999
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3296470..3297690 [+]
Producthypothetical protein
NoteTssL
UniProt IDA8GG60
KEGG IDspe:Spro_2999
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-69, Aligned region: 12..217
DUF2077 [PF09850], Evalue: 5.60E-69, Aligned region: 358..380
OmpA [PF00691], Evalue: 1.70E-15, Aligned region: 282..380
Protein Sequence: 406 a.a.     [Download]
>gi|157371239|ref|YP_001479228.1| hypothetical protein Spro_2999 [Serratia proteamaculans 568]
MTQENNITPAGNPLVEAANPLLNAISQIRQSATHANPAQLRQQLIDKVRHFELQGQRANLPYEVIIGARY
CLCTALDEAAALTPWGSSSVWSGSGLLVTFHNETWGGEKFFQLLAKLSQSPREHIQLLELINFCLLLGFE
GRYRVMENGRSQLETMKQRLLQLIRSVRGGYAPPLSPNALDLPVQQKLWRPLVPLWACVALTGFLASLLF
IGLNWRLGDSTSPVLAAIYQTNLPQVAISNPAPAAPPTLSLKSFLRKEIAEGLVVVRDEAQQSVVILKGD
GLFDSAATTVRGNYIPVIDRIAAAMNGVSGKILVTGYSDNLPIRSARFASNWELSLARADAVSAQLQKHL
DNPQRVKAEGRGESNPVAPNNSKVNRALNRRVEITLLVAPENTQAEINGLPQGNGK
 
Nucleotide Sequence: 1221 bp     [Download]
>ref|NC_009832.1|:3296470-3297690 hypothetical protein Spro_2999 [Serratia proteamaculans 568]
ATGACTCAGGAAAATAACATAACGCCGGCAGGCAACCCGTTGGTAGAAGCCGCGAACCCTTTGCTGAACG
CCATTTCGCAAATCCGCCAATCGGCCACCCACGCCAATCCGGCGCAGCTGCGCCAGCAACTGATCGATAA
AGTTCGCCACTTCGAACTCCAGGGTCAGCGCGCCAACCTGCCGTATGAAGTGATTATCGGCGCACGTTAT
TGCCTGTGTACCGCGCTGGACGAAGCCGCCGCGCTAACGCCCTGGGGCAGCAGCAGCGTCTGGTCCGGCA
GCGGACTGTTGGTGACTTTCCACAACGAAACCTGGGGCGGAGAGAAGTTCTTCCAACTGCTGGCCAAGCT
GTCGCAAAGCCCACGCGAACACATCCAACTGCTGGAACTGATTAACTTCTGCCTGCTGCTGGGGTTCGAA
GGCCGCTATCGAGTGATGGAGAACGGCCGCTCGCAGTTGGAAACCATGAAGCAACGTCTGCTGCAACTGA
TCCGCTCGGTACGCGGCGGTTACGCCCCGCCACTGTCCCCCAACGCACTGGATCTGCCGGTACAGCAAAA
ATTGTGGCGCCCTCTGGTGCCATTATGGGCCTGCGTAGCACTGACCGGTTTTCTGGCGTCGTTGCTGTTT
ATCGGCCTCAACTGGCGGCTGGGCGACAGCACCAGTCCGGTGCTGGCAGCCATTTATCAGACCAACCTGC
CACAGGTTGCCATCAGCAATCCGGCACCGGCGGCACCACCGACGCTGAGCCTGAAAAGCTTCCTGCGCAA
AGAAATTGCCGAAGGTCTGGTGGTGGTGCGTGACGAAGCTCAGCAGAGCGTGGTGATCCTGAAAGGGGAT
GGCCTGTTCGACTCCGCCGCAACGACGGTGCGCGGCAACTATATCCCGGTCATTGACCGCATTGCCGCGG
CGATGAACGGCGTCAGCGGCAAGATCCTGGTCACCGGCTACAGCGATAATCTGCCGATCCGCAGCGCACG
CTTCGCTTCCAACTGGGAGTTGTCGCTGGCACGCGCCGACGCGGTCAGCGCCCAACTGCAGAAACACCTC
GACAACCCGCAACGGGTGAAGGCGGAAGGCCGCGGTGAAAGCAACCCGGTCGCACCGAACAATAGCAAAG
TGAACCGCGCGCTGAATCGCCGGGTAGAAATTACGCTGTTGGTTGCGCCAGAAAATACCCAGGCGGAAAT
CAACGGCTTGCCGCAAGGAAACGGAAAGTAA