SecReT6
Protein ID: 157371243
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3003
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3303219..3303755 [+]
Producthypothetical protein
NoteTssB
UniProt IDA8GG64
KEGG IDspe:Spro_3003
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-60, Aligned region: 13..165
Protein Sequence: 178 a.a.     [Download]
>gi|157371243|ref|YP_001479232.1| hypothetical protein Spro_3003 [Serratia proteamaculans 568]
MPNSKSRSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKSVDPQASVDERKFLEIDID
NFDERMKSLKPRVAYQVDNTLTGEGKLNIDLTFESMEDFSPAAIARKVDALDNLLDARTQLSNLLSYMDG
KNGAEELISKILQNPALLQSLTDAPKPAATDDNNQRED
 
Nucleotide Sequence: 537 bp     [Download]
>ref|NC_009832.1|:3303219-3303755 hypothetical protein Spro_3003 [Serratia proteamaculans 568]
ATGCCAAACTCGAAATCCCGTAGCGGGCAGAAATTTATCGCCCGCAACCGCGCACCGCGCGTACAGATTG
AATACGATGTCGAAATTTATGGCGCAGAGCGCAAAATCCAGTTGCCGTTCGTGATGGGCGTGATGGCAGA
CCTGGTGGGGAAATCGGTTGATCCACAGGCGAGCGTTGATGAGCGCAAGTTCCTGGAGATCGACATCGAC
AACTTCGATGAACGCATGAAATCGCTGAAACCGCGCGTTGCCTATCAGGTCGACAACACCCTGACCGGCG
AAGGCAAACTGAATATCGATCTGACGTTTGAAAGCATGGAAGACTTCTCCCCTGCGGCGATTGCCCGCAA
GGTGGACGCGCTGGACAACCTGCTGGACGCCCGCACCCAGCTTTCCAACCTGTTGTCTTATATGGATGGT
AAAAACGGCGCTGAAGAACTGATCTCCAAAATCCTGCAAAACCCGGCCTTACTGCAATCCCTGACCGATG
CGCCGAAACCGGCCGCCACGGACGACAACAATCAGCGTGAGGACTAA