SecReT6
Protein ID: 157371244
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3004
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3303759..3305264 [+]
Producthypothetical protein
NoteTssC
UniProt IDA8GG65
KEGG IDspe:Spro_3004
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-196, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|157371244|ref|YP_001479233.1| hypothetical protein Spro_3004 [Serratia proteamaculans 568]
MSNSPQQQKALQTSEAFSSDEFSALLNKEFRPKTDQAKEAVENAVKTLAQQALENTVTVSSDAYRTIQAL
IAEIDEKLSQQVNQIIHHAEFQKLEGAWHGLHYLVNNSETDEMLKIRFMSISKQELGRTLKRHKGVGWDQ
SPIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMAKISAASHCPFIAGTAPSVMQMESWQEL
SNPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLARLPYGIRTNPVDEFDFEEETDGANHGNYTWT
NAAYAMAANINRSFKEFGWCTAIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQKPAEYYDADASANAQLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPANSSQETKSRKPLAAAEVQVEEIEDNPGYYSAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNDAS
 
Nucleotide Sequence: 1506 bp     [Download]
>ref|NC_009832.1|:3303759-3305264 hypothetical protein Spro_3004 [Serratia proteamaculans 568]
ATGAGCAACTCGCCTCAGCAACAAAAAGCGCTGCAGACCAGCGAAGCTTTCTCCAGCGATGAATTCAGCG
CGCTGCTGAACAAAGAGTTTCGTCCCAAGACCGATCAGGCCAAGGAAGCGGTAGAAAATGCGGTAAAAAC
CCTGGCGCAGCAGGCGCTGGAAAACACCGTGACGGTCTCCTCTGACGCCTATCGCACCATTCAGGCGCTG
ATCGCCGAAATCGACGAAAAACTGTCGCAACAGGTTAACCAGATTATCCACCACGCCGAATTCCAGAAGC
TGGAAGGCGCCTGGCATGGCCTGCACTATCTGGTCAACAACTCCGAAACCGATGAAATGCTGAAAATCCG
CTTTATGAGCATTTCCAAGCAGGAGCTGGGCCGCACGCTGAAGCGCCATAAAGGTGTGGGCTGGGATCAG
AGCCCCATCTTCAAGAAAGTGTACGAGGAAGAGTACGGCCAGTTCGGCGGCGAACCCTTCGGTTGCCTGG
TGGGCGATTACTACTTCGACCACAGCCCACAGGACGTAGAGTTGCTGGGTGAGATGGCGAAAATCAGTGC
CGCCTCCCACTGCCCCTTCATCGCCGGTACCGCACCGAGCGTGATGCAGATGGAATCCTGGCAGGAGCTG
TCCAACCCACGCGATTTGACCAAGATCTTCCAAAATACCGAATACGCCGCCTGGCGCAGCCTGCGTGAAT
CGGAAGATGCCCGCTATCTGGGCCTGGTAATGCCGCGATTCCTGGCGCGCCTGCCGTATGGCATCCGAAC
CAATCCGGTTGACGAGTTCGACTTTGAGGAAGAAACCGACGGCGCGAACCACGGTAACTACACCTGGACC
AACGCCGCCTACGCCATGGCCGCCAACATCAACCGTTCGTTCAAAGAGTTCGGTTGGTGTACCGCGATCC
GTGGGGTGGAGTCTGGCGGTGCGGTAGAGAACCTGCCGTGCCACACCTTCCCAAGCGACGACGGCGGCGT
GGACATGAAGTGCCCGACCGAGATCGCCATCAGCGATCGTCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGTTGGTACACCGGAAAAACTCCGACTTTGCCGCCTTTATCGGTGCCCAGTCGCTGCAAAAGCCGG
CCGAATACTACGACGCCGATGCATCTGCCAATGCTCAACTCTCCGCCCGTCTGCCTTATCTGTTCGCCTG
CTGCCGCTTCGCGCATTACCTGAAGTGCATCGTCCGTGACAAGATCGGTTCTTTCCGCGAGCGCGACGAT
ATGGAACGCTGGTTAAACGACTGGATCATGAACTACGTGGATGGCGATCCGGCCAACTCCTCGCAGGAAA
CCAAGTCGCGCAAACCGCTGGCCGCTGCGGAAGTTCAGGTGGAAGAGATCGAAGACAACCCGGGCTACTA
CAGCGCCAAGTTCTTCCTGCGCCCACATTACCAATTGGAAGGCTTGACCGTCTCCCTGCGTCTGGTATCG
AAACTGCCCTCACTGAAGCAGAACGACGCATCCTGA