SecReT6
Protein ID: 157371249
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3009
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3309777..3310592 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDA8GG70
KEGG IDspe:Spro_3009
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.80E-43, Aligned region: 29..70
ImpE [PF07024], Evalue: 1.80E-43, Aligned region: 146..267
Protein Sequence: 271 a.a.     [Download]
>gi|157371249|ref|YP_001479238.1| virulence protein SciE type [Serratia proteamaculans 568]
MKSLTNMLQGGTVSAAIGAVENEIKARPADADLRAALVQLLCLAGNWQRANAQLKSWQALKPIAQPTTLL
LMQSVNAELQRQAVFAGEAPPALLQQSQPWLQPMIQALRHDALGETEQAQALRDDALEAAPASAGQLTLA
ERPQPVAFDWLTDGDGRLGPVCELALNGTYYWLPFAEIAEIQFQAPQSAVDLVWSHALVRLNDGREQVCQ
LPARYPLNAGSDDALLLGKRTEWQALGEGPHYAGQGLKTWLSENDEFPLHSLRHLSFNASA
 
Nucleotide Sequence: 816 bp     [Download]
>ref|NC_009832.1|:3309777-3310592 virulence protein SciE type [Serratia proteamaculans 568]
GTGAAATCATTAACAAACATGTTGCAAGGCGGCACGGTCAGCGCCGCTATCGGCGCAGTGGAAAATGAAA
TCAAAGCGCGACCGGCGGATGCCGATCTGCGTGCCGCTCTGGTGCAACTGCTGTGTCTGGCCGGCAACTG
GCAGCGCGCCAATGCGCAGCTGAAATCCTGGCAGGCATTGAAGCCCATCGCCCAGCCCACCACATTGCTG
TTAATGCAATCGGTCAACGCGGAACTGCAGCGTCAGGCGGTGTTCGCCGGCGAGGCCCCTCCCGCGCTGC
TGCAACAAAGTCAGCCCTGGTTGCAACCCATGATCCAGGCGTTGCGTCACGATGCCCTGGGCGAAACCGA
ACAGGCGCAGGCATTGCGCGACGACGCGCTGGAAGCGGCACCGGCCAGTGCCGGGCAACTGACCCTGGCT
GAACGGCCACAGCCCGTGGCGTTTGATTGGTTGACCGACGGTGATGGTCGTCTCGGCCCGGTTTGCGAAC
TGGCATTGAACGGCACCTATTACTGGCTGCCGTTCGCCGAGATTGCGGAAATTCAGTTCCAGGCCCCACA
AAGCGCCGTCGATCTGGTGTGGAGCCACGCACTGGTGCGACTGAACGACGGTCGCGAGCAGGTCTGCCAG
CTGCCTGCCCGCTATCCCCTGAACGCAGGCAGTGACGATGCGCTGTTGCTCGGCAAACGCACCGAATGGC
AAGCGCTGGGCGAAGGGCCGCACTACGCCGGTCAGGGTCTGAAAACCTGGCTGAGCGAGAACGATGAGTT
CCCGCTACACAGCCTGCGCCACCTGAGTTTTAACGCGAGCGCCTGA