SecReT6
Protein ID: 157371250
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3010
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3310595..3311170 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA8GG71
KEGG IDspe:Spro_3010
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-18, Aligned region: 59..170
Protein Sequence: 191 a.a.     [Download]
>gi|157371250|ref|YP_001479239.1| GPW/gp25 family protein [Serratia proteamaculans 568]
MNSKRPTQHDDGDLRRQGYRSRQDSERLTSRDKMQPVLLDMLTDDEPQKKKEAQVRNLVSHSELRRRVLR
DLQWLFNCVNSEASLDLGDFPQVRRSTLNYGIASLAGKRMSDIEWQDIQLALTESILNFEPRILPEGLQV
RCISDTGSLELHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFDLKDIG
 
Nucleotide Sequence: 576 bp     [Download]
>ref|NC_009832.1|:3310595-3311170 GPW/gp25 family protein [Serratia proteamaculans 568]
ATGAACAGCAAGCGGCCAACCCAACATGATGATGGTGACCTGCGCCGTCAGGGCTATCGCTCCCGCCAGG
ACAGCGAACGCCTGACCTCGCGCGACAAAATGCAGCCGGTGCTGCTCGACATGCTGACCGACGACGAACC
GCAGAAAAAAAAGGAAGCTCAGGTGCGCAACCTGGTCTCGCACAGCGAACTGCGCCGTCGGGTGCTGCGC
GACCTGCAGTGGCTGTTTAACTGCGTGAACAGCGAAGCCAGTCTCGATTTGGGCGATTTTCCGCAGGTAC
GGCGTTCAACCCTGAACTACGGCATCGCCTCGCTGGCCGGCAAACGCATGTCAGACATCGAATGGCAGGA
TATCCAGTTGGCGCTGACCGAATCCATCCTCAATTTCGAACCGCGCATCCTGCCCGAAGGGCTGCAGGTG
CGCTGCATTTCAGATACCGGCTCGCTGGAGCTGCACAACGTATTGTCGATTGAAATCAAGGGGCGCCTGT
GGTGTGTGCCCTATCCGCTGGAGTTTCTGTTCCGTACCGACGTGGACCTGGAGAACGGCCACTTCGATCT
GAAAGACATAGGGTAA