SecReT6
Protein ID: 157371251
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3011
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3311175..3313061 [+]
Producthypothetical protein
NoteTssF
UniProt IDA8GG72
KEGG IDspe:Spro_3011
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-215, Aligned region: 5..628
Protein Sequence: 628 a.a.     [Download]
>gi|157371251|ref|YP_001479240.1| hypothetical protein Spro_3011 [Serratia proteamaculans 568]
MDSKLLDYYNRELAYLREMGAEFAEQYPKVAGRLGMRGIDVADPYIERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEIIYPNYLSPTPSMAIAELQPDSNKGDISNGFVVPRGTMMDSQSLKKSGITCSYTTAHDVTLQP
VRLKSVELGGIPADIPLAALGLQHSGCVSALRIRLECYDSVTLNNLQLDQLMFYLSGPDLQAQQLLELLM
QHSVGLICQTVEAQPQRRVLALDELRQEGFAADQALLPNDLRNFEGYRLLQEYFAFPARFQFFSVNGIRP
LLQSVREGKKTLRQFEILVLLDRQDAALERVIDVAHLALHCTPVINLFPKVAERITVSEKSHEYHLVVDN
IRPLDYEVFSVQRLGGSASEKRYEQEFRPFYSTLSADDGNYGAYFSLRREQRTLSEHARRYGTRTGYVGS
EVFVSLVDERQSPWHSDLKYLTADVLCTSRDLPLMLLQQDQGNFVMPDSIPIKQVSLKKGPTPPRPALAE
GMITWRLISQLQLNYLSMMDGDPEQGAASLRQLLGLYGNLSEPAITKQIQGVRHCNLRPVYRRVPEPGPI
VFARGIAIDLTVDEQSFSGSSPYLLGSVLERLFSRLVAMNTFTEMTLSSQQRGEIAHWQARMGKRTLI
 
Nucleotide Sequence: 1887 bp     [Download]
>ref|NC_009832.1|:3311175-3313061 hypothetical protein Spro_3011 [Serratia proteamaculans 568]
ATGGACAGTAAACTTTTAGACTATTACAACCGCGAGCTGGCCTATCTGCGTGAGATGGGCGCAGAGTTCG
CCGAGCAATATCCCAAAGTGGCAGGCCGCCTTGGCATGCGCGGTATCGACGTAGCGGATCCTTATATCGA
GCGTCTGATGGAAGGCTTTGCCTTTCTCACCTCGCGCGTACAACTGAAGATGGACGCAGAGTTTCCACGT
TTCTCCCAGCGTCTGCTGGAGATCATCTACCCCAACTATCTGTCGCCAACGCCATCGATGGCGATTGCCG
AGCTGCAACCCGACAGCAACAAGGGCGATATCAGCAACGGCTTTGTCGTGCCACGCGGCACCATGATGGA
CAGCCAGTCGCTGAAAAAGAGTGGCATCACCTGCAGCTACACCACCGCGCACGACGTCACGCTGCAGCCG
GTGCGGCTGAAAAGCGTCGAACTGGGCGGCATTCCGGCCGATATTCCACTGGCCGCTCTGGGGTTGCAGC
ACAGTGGCTGCGTCAGCGCGCTGCGCATCCGGCTGGAGTGCTATGACAGCGTCACGCTCAACAACCTGCA
GTTGGACCAGTTGATGTTTTATCTCTCCGGCCCGGACTTGCAGGCACAGCAACTGCTGGAACTGCTGATG
CAGCACAGCGTCGGGCTGATTTGCCAGACGGTGGAAGCGCAACCGCAGCGGCGGGTGCTGGCACTGGACG
AGTTGCGACAGGAAGGCTTCGCCGCCGATCAGGCACTGCTGCCGAACGATCTGCGCAATTTTGAAGGCTA
TCGCCTGCTGCAGGAGTATTTTGCCTTTCCGGCGCGCTTTCAGTTCTTCAGCGTCAATGGCATACGCCCA
CTGTTGCAAAGCGTACGCGAAGGCAAAAAAACGCTGCGGCAGTTTGAGATCCTGGTGCTGCTTGACCGTC
AGGATGCGGCACTGGAGCGGGTAATCGACGTCGCCCATTTGGCGTTGCACTGCACGCCGGTGATTAATCT
GTTCCCCAAGGTCGCCGAACGCATCACGGTCAGCGAAAAAAGCCATGAATATCATCTGGTGGTCGATAAC
ATTCGTCCGCTTGATTATGAGGTGTTCTCTGTTCAGCGGCTCGGTGGCAGCGCCAGCGAAAAACGCTATG
AGCAGGAATTCCGGCCGTTTTACAGCACCCTGAGCGCGGATGACGGCAACTACGGCGCCTACTTTTCACT
GCGGCGCGAACAGCGCACGTTGTCCGAACACGCCCGTCGCTACGGCACCCGCACCGGCTATGTCGGCTCG
GAAGTGTTCGTCTCGCTGGTGGATGAACGGCAGTCGCCGTGGCACAGCGACCTGAAATACCTCACCGCCG
ACGTGCTGTGTACCAGTCGCGATCTGCCGCTGATGCTGTTGCAGCAGGATCAGGGCAATTTCGTGATGCC
GGACTCGATCCCGATCAAACAGGTGTCGCTGAAAAAAGGCCCGACGCCGCCGCGCCCGGCGCTGGCCGAA
GGCATGATCACCTGGCGGCTGATCAGCCAACTGCAATTGAACTACCTCAGCATGATGGACGGCGACCCGG
AACAGGGGGCTGCCAGCCTGCGTCAGCTGCTCGGCCTGTACGGCAACCTGAGCGAGCCGGCGATCACCAA
GCAGATCCAGGGTGTTCGCCACTGTAACCTGCGCCCGGTATACCGCCGGGTACCCGAGCCGGGGCCGATC
GTGTTTGCCCGCGGTATCGCCATCGACCTGACCGTGGATGAACAGTCATTCTCCGGCAGCAGCCCCTACC
TGCTGGGTAGCGTTCTGGAGCGTTTGTTCTCCCGGCTGGTAGCGATGAACACCTTTACCGAAATGACGCT
TTCCAGCCAGCAGCGCGGTGAGATTGCGCACTGGCAGGCGCGCATGGGCAAAAGGACGCTGATTTGA