SecReT6
Protein ID: 157371252
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3012
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3313058..3314131 [+]
Producthypothetical protein
NoteTssG
UniProt IDA8GG73
KEGG IDspe:Spro_3012
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-107, Aligned region: 33..335
Protein Sequence: 357 a.a.     [Download]
>gi|157371252|ref|YP_001479241.1| hypothetical protein Spro_3012 [Serratia proteamaculans 568]
MSTLDAEAELTAPPQINALHRLPEDFWLRLGNAPYKHDLFQLLRRLDAQGGQPYLLGRAPLPRHEMLRLG
QEPSLSFAPSTLAQVSPRPQSSLHDVSIFSFGLFGPNGPLPLHLTEYVRERVYHHQDTTLLAFANLFHHR
LTLLFYRAWADAQPTVSLDRQDNRRFDQYLSSLIGIGQPAQQQRDSINAHAKHFMAGHLIRHSRDPEGLS
KILQQYFKVPVRIVENVPHWLRVEPREQARLKAGRGAPRLGESSFLGIAVRDIQHKFRIELGPMSQQNYE
GFLPGAELCRQLRDWVRQYLGIEFVWELRLILAKDQLSGTQLGGAQRLGLSSWLEDARQQRDLDDLIFSP
EPLENPF
 
Nucleotide Sequence: 1074 bp     [Download]
>ref|NC_009832.1|:3313058-3314131 hypothetical protein Spro_3012 [Serratia proteamaculans 568]
TTGAGCACTCTTGACGCCGAGGCGGAACTGACGGCACCGCCACAGATCAATGCCTTGCACCGCCTGCCGG
AGGATTTCTGGCTGCGGCTCGGCAATGCGCCTTATAAACACGATTTGTTTCAGCTGCTGCGGCGCCTCGA
CGCCCAGGGCGGCCAGCCATACCTGCTGGGCCGTGCCCCCCTGCCGCGCCATGAGATGCTGCGGCTGGGG
CAAGAACCTTCACTGTCGTTCGCTCCGTCGACGCTGGCACAGGTCAGCCCACGGCCGCAAAGCTCGCTGC
ACGACGTTTCTATTTTCAGCTTTGGCCTGTTTGGCCCCAACGGGCCGCTGCCGCTGCACCTGACCGAATA
CGTGCGTGAACGGGTCTATCACCACCAGGACACCACCCTGCTGGCCTTTGCCAACCTGTTTCACCACCGG
CTGACGCTGCTGTTTTACCGCGCCTGGGCCGACGCACAGCCCACGGTATCGCTGGATCGTCAGGATAACC
GGCGTTTCGACCAATACCTTTCCAGCCTGATTGGCATCGGCCAGCCGGCACAGCAGCAGCGCGACAGCAT
CAATGCCCATGCCAAGCATTTTATGGCCGGTCATCTGATTCGCCACAGCCGCGATCCGGAAGGCCTGAGC
AAAATCTTGCAGCAGTATTTCAAGGTGCCGGTGCGCATCGTGGAAAACGTCCCGCACTGGCTGCGGGTAG
AACCGCGCGAACAGGCGCGCCTGAAGGCCGGTCGCGGCGCCCCCCGGCTCGGTGAGTCTTCGTTCCTCGG
GATTGCCGTGCGCGATATTCAGCACAAATTCCGCATCGAACTGGGGCCGATGTCGCAACAAAACTATGAA
GGCTTCTTGCCCGGAGCCGAACTGTGCCGGCAGTTGCGCGACTGGGTGCGCCAGTATCTGGGCATTGAGT
TTGTTTGGGAACTGCGGCTGATCCTGGCCAAGGATCAGCTCAGCGGCACCCAACTCGGCGGTGCCCAGCG
CCTGGGATTAAGCAGTTGGCTGGAAGACGCCCGTCAGCAACGCGACCTTGACGATCTGATCTTCAGCCCC
GAACCGCTGGAAAACCCGTTCTGA