SecReT6
Protein ID: 157371253
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3013
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3314184..3316847 [+]
ProductATPase
NoteTssH
UniProt IDA8GG74
KEGG IDspe:Spro_3013
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-39, Aligned region: 224..243
AAA_2 [PF07724], Evalue: 1.80E-39, Aligned region: 618..783
AAA [PF00004], Evalue: 6.10E-21, Aligned region: 121..161
AAA [PF00004], Evalue: 6.10E-21, Aligned region: 224..357
AAA [PF00004], Evalue: 6.10E-21, Aligned region: 624..708
ClpB_D2-small [PF10431], Evalue: 4.70E-16, Aligned region: 205..218
ClpB_D2-small [PF10431], Evalue: 4.70E-16, Aligned region: 493..517
ClpB_D2-small [PF10431], Evalue: 4.70E-16, Aligned region: 791..866
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 350..373
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 623..741
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 33..79
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 127..163
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 201..241
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 483..555
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 619..668
Sigma54_activat [PF00158], Evalue: 3.10E-07, Aligned region: 218..238
Sigma54_activat [PF00158], Evalue: 3.10E-07, Aligned region: 295..304
Sigma54_activat [PF00158], Evalue: 3.10E-07, Aligned region: 623..738
Zeta_toxin [PF06414], Evalue: 8.40E-07, Aligned region: 123..169
Zeta_toxin [PF06414], Evalue: 8.40E-07, Aligned region: 222..240
Zeta_toxin [PF06414], Evalue: 8.40E-07, Aligned region: 617..673
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 123..147
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 622..658
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 59..78
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 224..304
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 330..390
AAA_14 [PF13173], Evalue: 1.70E-06, Aligned region: 622..733
AAA_19 [PF13245], Evalue: 1.90E-06, Aligned region: 223..246
AAA_19 [PF13245], Evalue: 1.90E-06, Aligned region: 621..645
AAA_17 [PF13207], Evalue: 7.40E-06, Aligned region: 224..277
AAA_17 [PF13207], Evalue: 7.40E-06, Aligned region: 452..509
AAA_17 [PF13207], Evalue: 7.40E-06, Aligned region: 623..659
AAA_25 [PF13481], Evalue: 7.80E-06, Aligned region: 218..248
AAA_25 [PF13481], Evalue: 7.80E-06, Aligned region: 279..321
AAA_25 [PF13481], Evalue: 7.80E-06, Aligned region: 613..645
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 16..77
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 224..259
NACHT [PF05729], Evalue: 2.20E-05, Aligned region: 623..662
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 208..245
IstB_IS21 [PF01695], Evalue: 6.30E-05, Aligned region: 623..648
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 216..241
AAA_29 [PF13555], Evalue: 7.40E-05, Aligned region: 621..648
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 203..237
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 277..306
Arch_ATPase [PF01637], Evalue: 0.00027, Aligned region: 622..665
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 0.00027, Aligned region: 624..652
FtsK_SpoIIIE [PF01580], Evalue: 0.00063, Aligned region: 212..267
FtsK_SpoIIIE [PF01580], Evalue: 0.00063, Aligned region: 459..508
FtsK_SpoIIIE [PF01580], Evalue: 0.00063, Aligned region: 612..642
TIP49 [PF06068], Evalue: 0.0053, Aligned region: 224..245
TIP49 [PF06068], Evalue: 0.0053, Aligned region: 273..304
TIP49 [PF06068], Evalue: 0.0053, Aligned region: 622..659
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 222..240
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 295..304
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 590..644
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 692..716
Hpr_kinase_C [PF07475], Evalue: 0.008, Aligned region: 224..236
Hpr_kinase_C [PF07475], Evalue: 0.008, Aligned region: 620..641
Clp_N [PF02861], Evalue: 0.0096, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.0096, Aligned region: 106..133
Protein Sequence: 887 a.a.     [Download]
>gi|157371253|ref|YP_001479242.1| ATPase [Serratia proteamaculans 568]
MSEISRSVLFGKLDSLLFTSLESATAFCKLRGNPYVELAHWLHQLMQAPEADLQQVIRHFALDEGQLARD
IVEALDRLPRGASAISDLSEHIDSAVERAWVYGSLKFGAAQIRGGHLLLGVLKTYSLRHLLKAISSQFDR
INADLLMEQFATITAHSAENSLTASAQADTTPTAAQTGGSVLAQYAQDLTAKARNGEIDPVTGRDEEIRQ
IVDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIVAGDVPPQLRDVQLYLLDIGMLQAGAGVKGEFEKRL
QTVIDEVQSSPTPIILFIDEIHTLIGAGGPQGTGDAANLLKPALARGQLRTVGATTWSEYKKYIEKDPAL
TRRFQVVQVHEPSEDKALLMLRSTVSPLEQHHRVLLLDEAVDAAVRLSHRYIPARQLPDKAVALLDTACA
RVAVSQHAEPAQVEDCRHRIEALQIEWDIARREAKVGIGNPQRPQDIEAQLALLQQQLEQLTARWQEELA
LIQQIIDLRAQLHREEIEAEPTDEATEEPQPAPSADELRAQLAQLQQQLGELQGEAPLIFAAVDANVVAA
VVSDWTGIPLGRMVKNEIDAVLQLADTLNQRVIGQRHALDLIARRVRTSRARLDDPNKPVGVFLLAGPSG
VGKTETALALAETLYGGEQNVITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDE
IEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRNTIIILTSNVGTDLIAGLCSDADLMPEPEALSGALREP
LLSVFPAALLGRLLVVPYYPLTDATLGNIVRLQLGRVQRRLAENHDIACTFDDAVIEQIVSRCTEVESGG
RMVDAILTNTLLPQISHTLLTGSANDQRYRQLHIALQQNEFICQFQA
 
Nucleotide Sequence: 2664 bp     [Download]
>ref|NC_009832.1|:3314184-3316847 ATPase [Serratia proteamaculans 568]
ATGTCTGAAATCAGCCGCTCGGTATTATTTGGCAAACTCGATAGCCTGTTATTCACCTCTCTGGAAAGTG
CGACGGCGTTTTGCAAGCTGCGCGGTAACCCCTACGTTGAGCTGGCGCACTGGCTGCATCAACTGATGCA
GGCACCGGAGGCGGACCTGCAACAGGTGATCCGCCACTTTGCGCTGGATGAGGGGCAACTGGCGCGTGAC
ATCGTCGAGGCGCTCGATCGCCTGCCGCGCGGTGCCAGCGCGATTTCCGATCTGTCCGAACATATCGACA
GCGCGGTGGAACGGGCCTGGGTTTATGGCTCACTGAAATTCGGTGCTGCGCAGATCCGCGGCGGCCACCT
GCTGCTCGGCGTCCTGAAAACCTACAGCCTGCGCCACTTGCTGAAAGCCATCTCCTCACAGTTTGATCGC
ATCAACGCCGATCTGCTGATGGAGCAATTTGCCACTATCACCGCCCACTCGGCGGAAAACAGCCTGACGG
CGAGCGCCCAGGCCGACACCACGCCGACGGCAGCGCAGACCGGTGGCAGCGTGCTGGCGCAATATGCTCA
GGATTTGACGGCCAAGGCGCGTAATGGCGAGATTGACCCGGTGACCGGGCGTGACGAGGAAATCCGCCAG
ATTGTCGATATTCTGATGCGTCGCCGCCAGAACAACCCGCTGCTGACCGGTGAGGCCGGGGTTGGCAAAA
CCGCCGTGGTCGAAGGCCTGGCGCTGCGTATCGTGGCCGGTGACGTTCCGCCACAGCTGCGCGACGTCCA
GCTGTATCTGCTGGATATCGGCATGCTGCAGGCCGGGGCTGGGGTGAAGGGCGAGTTCGAAAAACGCCTG
CAAACGGTGATTGACGAAGTTCAATCCAGCCCCACCCCGATCATTTTGTTTATCGATGAGATCCATACGC
TGATTGGTGCCGGTGGCCCACAGGGCACCGGCGACGCAGCCAACCTGTTGAAGCCGGCGCTGGCACGCGG
CCAATTACGTACCGTCGGGGCCACTACCTGGTCGGAATACAAAAAATACATTGAGAAAGATCCGGCGCTG
ACCCGCCGTTTCCAGGTGGTGCAGGTGCATGAACCGAGCGAAGACAAAGCGCTGCTGATGCTGCGCAGCA
CCGTCAGCCCGCTGGAACAGCACCACCGCGTGCTGCTGCTCGATGAGGCAGTCGACGCCGCCGTGCGCCT
GTCGCATCGCTACATCCCGGCACGCCAGTTGCCGGACAAGGCCGTGGCGCTGCTGGATACCGCCTGCGCC
CGCGTGGCGGTCAGCCAACATGCCGAGCCGGCCCAGGTGGAAGACTGCCGTCACCGCATTGAAGCGTTGC
AGATTGAATGGGATATCGCCCGGCGCGAAGCCAAGGTCGGTATCGGCAATCCGCAGCGCCCACAGGATAT
CGAGGCTCAGTTGGCACTGTTGCAACAACAACTCGAGCAGCTCACTGCCCGCTGGCAGGAGGAGTTGGCG
CTGATCCAACAGATTATCGACCTGCGCGCCCAGTTGCATCGGGAAGAAATTGAGGCTGAACCGACTGACG
AGGCCACCGAGGAGCCACAGCCCGCGCCCTCTGCCGATGAACTGCGCGCGCAATTGGCGCAGTTGCAGCA
ACAGCTTGGCGAACTGCAGGGCGAGGCCCCGCTGATTTTCGCCGCCGTCGATGCCAACGTGGTGGCCGCC
GTGGTGTCCGACTGGACCGGCATCCCGCTGGGCCGCATGGTGAAAAACGAGATCGACGCGGTACTGCAAT
TGGCGGATACGCTGAACCAGCGGGTTATCGGCCAACGGCATGCACTGGATCTGATCGCCCGTCGGGTACG
CACCTCACGCGCGCGGCTGGACGATCCGAACAAGCCGGTCGGGGTTTTCCTGTTGGCAGGCCCTTCCGGC
GTAGGGAAAACCGAAACCGCGCTGGCGCTGGCGGAAACGCTGTACGGCGGCGAGCAGAACGTGATTACCA
TCAACATGAGCGAGTTCCAGGAGTCGCATACCGTTTCAACCCTGAAAGGTGCCCCTCCCGGCTATGTGGG
TTACGGCGAGGGTGGCGTGCTGACCGAAGCGGTGCGCCGTCGCCCTTACAGCGTGGTGCTGCTGGACGAA
ATAGAAAAAGCCCACCCGGACGTGCACGAGATCTTCTTCCAGGTGTTCGACAAAGGCTGGATGGAGGATG
GCGAAGGCCGCCACATCGATTTCCGTAACACCATCATTATTCTGACCTCTAACGTCGGCACCGACCTGAT
CGCCGGGCTGTGCAGCGATGCGGACCTGATGCCGGAGCCGGAGGCACTGAGCGGCGCCCTGCGCGAACCG
CTGCTGTCGGTATTCCCGGCGGCGCTGCTCGGCCGCTTGCTGGTGGTGCCTTACTACCCACTGACCGACG
CCACGCTGGGCAATATTGTGCGCCTGCAACTGGGACGAGTGCAGCGCCGACTGGCGGAGAACCACGATAT
CGCCTGTACCTTCGACGATGCGGTGATCGAGCAAATCGTCAGCCGCTGCACCGAGGTGGAGTCCGGCGGC
CGCATGGTCGACGCTATTTTGACCAACACCCTGCTGCCGCAGATCAGCCACACCTTACTGACCGGCAGCG
CCAACGATCAGCGCTATCGCCAACTGCATATCGCGCTGCAGCAAAACGAGTTTATTTGTCAATTTCAGGC
ATAA