SecReT6
Protein ID: 157371255
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3015
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3318424..3320361 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA8GG76, A8GG76
KEGG IDspe:Spro_3015
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-77, Aligned region: 24..330
Phage_base_V [PF04717], Evalue: 2.10E-24, Aligned region: 368..461
Gp5_C [PF06715], Evalue: 8.90E-05, Aligned region: 504..526
Gp5_C [PF06715], Evalue: 8.90E-05, Aligned region: 536..550
Gp5_C [PF06715], Evalue: 8.90E-05, Aligned region: 592..599
Protein Sequence: 645 a.a.     [Download]
>gi|157371255|ref|YP_001479244.1| Rhs element Vgr protein [Serratia proteamaculans 568]
MLDRIIAHTPLGQESLLFRSLEGTEALSSPFDFAIELLSKNARLDRKALLGQPLTLEIPTQGFLGPPRYL
NGKITSIAVSSEEIGGTRYAVYNLHVQPDLWPMTKDRNFRIFQEQTVPQIVKTLLTEHNVQLEDQLTGDY
RLWGYCVQYNESSFNFISRLMELEGIYYYFKHEMDKHTLVLGDAPHHHQPYPGYEMIPYHLTPSGGSTSE
EGISQWTLSDHVTPGIYSLDDYDFRKPNAWLFQARQNPASPTPGQIDVYDWPGRYTEHQQGEFYARIRQE
AWQAEHQQIEGTATALGIAPGSTFTLYNAPHADDNREYLTLQAKYHLKENRYASGDDQHSEHRIDFTVLP
ADIPWHPAQQASWPKTHGPQTAKVVGPAGESIWTDKYGRIKVKFHWDRFGPKDDGSSCWVRVSSAWAGQG
YGGVQIPRVNDEVVVDFINGDPDRPIVTGRVYNDASMPPWALPAAATQMGFMSRTKDGTADNANALRFED
KAGSEQVWIQAERNMDTQVKNDESHTIDKNHTHFVGANEEQRVIEDQTIAVKGHSTMLTEHTRTDNVIGA
LVIGSGTSIRLECGKSVLELTKDGDINITGINFNITVDQSGEINTSSGKLNLNPSSGQKKTDAPGDEHQK
TIQSQIDSFFSQEEK
 
Nucleotide Sequence: 1938 bp     [Download]
>ref|NC_009832.1|:3318424-3320361 Rhs element Vgr protein [Serratia proteamaculans 568]
ATGTTGGATCGTATTATTGCGCATACGCCACTGGGCCAGGAGTCATTACTGTTCCGTTCGCTGGAAGGGA
CTGAAGCCCTTTCCTCACCCTTCGATTTCGCCATCGAACTGCTGAGCAAAAACGCCCGCCTCGACCGCAA
AGCGCTGCTGGGCCAACCCCTGACGCTGGAGATCCCGACCCAGGGTTTTCTTGGCCCGCCCCGCTACCTG
AACGGCAAGATCACGTCGATCGCCGTCAGCAGCGAAGAGATCGGCGGCACCCGTTATGCGGTGTACAACC
TGCACGTGCAGCCGGATCTGTGGCCGATGACCAAGGACCGCAACTTCCGCATCTTCCAGGAACAGACGGT
GCCGCAGATCGTCAAAACCCTGCTGACCGAACATAATGTTCAGTTGGAAGACCAGCTCACGGGCGACTAC
CGCCTGTGGGGCTATTGCGTGCAGTACAACGAGAGCAGCTTCAACTTCATCAGCAGGCTGATGGAGCTGG
AGGGTATCTATTACTATTTCAAACATGAGATGGACAAGCACACCCTGGTGCTGGGCGATGCGCCTCACCA
TCATCAGCCCTATCCGGGCTATGAGATGATCCCTTACCATCTGACGCCGTCTGGCGGCAGTACCAGCGAA
GAAGGCATCAGCCAGTGGACCCTGTCCGATCACGTCACGCCGGGTATTTACAGCCTCGACGATTACGACT
TCCGCAAACCCAATGCCTGGCTGTTCCAGGCCCGTCAGAACCCCGCCTCACCGACGCCGGGCCAGATTGA
CGTTTACGACTGGCCGGGCCGCTATACCGAGCATCAGCAGGGGGAATTCTACGCCCGTATCCGTCAGGAA
GCCTGGCAGGCCGAGCATCAGCAGATTGAAGGCACCGCTACCGCACTGGGCATTGCCCCCGGCAGCACCT
TCACGCTGTATAACGCCCCGCATGCGGACGACAACCGGGAATATCTGACGCTGCAGGCCAAATATCACCT
GAAGGAAAACCGCTACGCCAGCGGCGACGATCAGCACAGCGAACACCGTATCGATTTCACCGTGCTGCCG
GCGGATATTCCCTGGCACCCGGCGCAACAGGCCAGTTGGCCAAAAACTCACGGCCCGCAGACGGCAAAAG
TGGTCGGCCCGGCCGGTGAGTCGATCTGGACCGACAAATACGGCCGCATCAAGGTGAAATTCCACTGGGA
TCGCTTCGGGCCGAAAGACGACGGCAGCTCCTGCTGGGTGCGCGTGTCCAGCGCCTGGGCCGGCCAGGGT
TATGGCGGAGTACAGATCCCGCGCGTCAACGACGAAGTGGTGGTGGACTTTATCAATGGCGATCCGGACC
GGCCGATCGTGACCGGTCGCGTGTATAACGACGCCAGTATGCCGCCCTGGGCACTGCCGGCCGCCGCAAC
CCAGATGGGTTTTATGAGCCGCACTAAGGATGGCACCGCCGACAACGCCAACGCCCTGCGCTTCGAGGAT
AAAGCCGGTTCGGAACAGGTATGGATCCAGGCGGAACGCAACATGGACACCCAGGTGAAGAACGATGAGA
GCCATACCATCGATAAGAACCATACGCATTTCGTTGGTGCTAATGAGGAACAGCGGGTTATCGAAGACCA
GACTATTGCGGTTAAAGGCCACTCAACCATGCTGACTGAGCATACGCGTACAGATAACGTTATCGGCGCA
TTGGTTATTGGCTCTGGTACGTCGATTCGTCTTGAATGTGGCAAAAGCGTGTTGGAACTGACCAAAGATG
GTGACATTAATATTACCGGTATTAATTTTAATATTACCGTTGACCAATCTGGCGAAATTAACACATCCAG
CGGCAAGCTAAATCTCAACCCTTCGAGTGGCCAGAAGAAAACCGATGCGCCAGGCGACGAACATCAAAAA
ACAATTCAAAGTCAAATAGACAGTTTTTTCTCACAGGAAGAAAAGTAA