SecReT6
Protein ID: 157371259
SecReT6 ID234
T6SS typei3
Gene symbol-
Locus tagSpro_3019
StrainSerratia proteamaculans 568
Repliconchromosome [GenBank: NC_009832] [Browse all T6SS(s) in this replicon]
Location [Strand]3324102..3324584 [+]
Producthypothetical protein
NoteTssD
UniProt IDA8GG80, A8GG80
KEGG IDspe:Spro_3019
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-36, Aligned region: 6..135
Protein Sequence: 160 a.a.     [Download]
>gi|157371259|ref|YP_001479248.1| hypothetical protein Spro_3019 [Serratia proteamaculans 568]
MAIDSFLKVDGVTGESNDSNHKNWTDILSFNWGATQSGNMAVGGGGGTGKVNFKDLEVQALIDKSTPAIL
KFCSSGKHVTKVELSICKAGGTQVEYTRIVLEDVLVSMADFTGVGHTDNILVKYRFQASKVNLHYWEQSA
SGTKGAETKAGWDIKQNKEI
 
Nucleotide Sequence: 483 bp     [Download]
>ref|NC_009832.1|:3324102-3324584 hypothetical protein Spro_3019 [Serratia proteamaculans 568]
ATGGCAATTGACTCATTTCTGAAGGTTGACGGGGTTACTGGCGAATCTAATGATTCGAATCACAAAAATT
GGACTGATATTCTGTCATTCAACTGGGGGGCGACCCAGTCTGGCAATATGGCCGTAGGCGGTGGCGGCGG
GACGGGGAAAGTAAACTTCAAGGATTTGGAGGTGCAGGCACTTATCGATAAATCTACACCGGCCATTCTG
AAGTTTTGCTCCAGCGGTAAACATGTAACCAAAGTAGAACTTTCTATCTGCAAGGCCGGGGGCACCCAGG
TCGAATATACCAGGATCGTGCTGGAAGATGTCCTGGTCAGTATGGCGGACTTTACCGGTGTTGGGCACAC
CGACAATATCCTGGTTAAATATCGTTTTCAGGCTTCCAAGGTCAATCTGCATTACTGGGAGCAAAGCGCC
AGCGGCACCAAGGGTGCAGAAACCAAAGCCGGTTGGGATATTAAACAGAATAAAGAGATTTAA