SecReT6
Protein ID: 15799897
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0248
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]243534..244013 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ8X7X3
KEGG IDece:Z0248, ecs:ECs0216
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.70E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|15799897|ref|NP_285909.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c244013-243534 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTTCTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA