SecReT6
Protein ID: 15799898
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0249
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]243979..245478 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8X7X1
KEGG IDece:Z0249
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.20E-44, Aligned region: 322..466
ImpA-rel_N [PF06812], Evalue: 6.90E-21, Aligned region: 71..130
Protein Sequence: 499 a.a.     [Download]
>gi|15799898|ref|NP_285910.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPEL
NWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLD
WFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACS
VAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADS
RWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNG
EFNLFNTKW
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c245478-243979 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
GTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACAC
ACTGTACTGAGGAGGCAGGGATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCG
CGGGCTGCCGGAATTCAGCGCCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTG
AACTGGAAACTGGTGGAGTCGCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCA
CCTACTATACGCTTGCCCGGACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGC
GGCAATGGTAAGCCACGACTGGGATAAGTTCTGGCCGCARGGCGGCCCGGCGCGTACTGAAATGCTGGAC
TGGTTTAACTCCCGAACCGGCAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGA
TCTACCGCACAGAGCGGGCATTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCC
GCGCGTGGAGAATCTGCTCTATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAAC
ACTGAGAACGCCGCACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACAC
CAGAAGCGGTAGTGCCTCCCCTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAA
TCCCCCACAGGCCAGTGTGATAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCA
GTGGCTGTCGCCTCAGCATTGTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACG
ACACCGCTCAGGGCGCAGCAACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCA
ACAACTTCTTGATACCTCCCCGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGT
CGCTGGCCGGAAAGCCTGCAACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCAC
AGAGTAGCCCGCAGTTGCGTGGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGAT
GCAGCGCGAGAAAGAGGGACTAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTG
GGGCAGGAAACACCCGTTGAGTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAG
ATGCGCTGGAAAAACAAATTAATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAA
TACGATACCGACGATAAAAAAAGCATTGAATTTCAATAACATTCATGAATACAAAGGAGTTTTAAATGGC
GAATTTAATTTATTTAACACTAAATGGTGA