SecReT6
Protein ID: 15799900
SecReT6 ID6
T6SS typei1
Gene symbol-
Locus tagZ0251
StrainEscherichia coli O157:H7 str. EDL933
Repliconchromosome [GenBank: NC_002655] [Browse all T6SS(s) in this replicon]
Location [Strand]248970..249764 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ8X7W2
KEGG IDece:Z0251, ecs:ECs0220
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 264 a.a.     [Download]
>gi|15799900|ref|NP_285912.1| unnamed protein product [Escherichia coli O157:H7 str. EDL933]
MTQPSAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAA
VSADMVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQ
LTGLLFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQF
HRQYLAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 795 bp     [Download]
>gi|16445223|ref|NC_002655.2|:c249764-248970 Escherichia coli O157:H7 str. EDL933 chromosome, complete genome
GTGACGCAACCCAGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACA
CGCTGTTAAAAGTGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCG
CCATGCCCTGTGGCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCG
GTCTCTGCCGATATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGG
TTGAGAAAAGCGTATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCG
TCTGGGTTACAAACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAG
CTTACCGGGCTGCTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTT
CGCCCGACGGCAAAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGC
TGGGCAGGGTCTGGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTT
CACCGCCAGTACCTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACC
GGATGTTGTTGATGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGA
ACAAAAATTCACGGCAGAACAATAA